KEGG   Miniopterus natalensis (Natal long-fingered bat): 107531164
Entry
107531164         CDS       T05883                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00250  Alanine, aspartate and glutamate metabolism
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107531164 (RIMKLA)
Enzymes [BR:mna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     107531164 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     107531164 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST Dala_Dala_lig_C ATP-grasp ATP-grasp_3 CPSase_L_D2 ATPgrasp_YheCD Synapsin_C TTL
Other DBs
NCBI-GeneID: 107531164
NCBI-ProteinID: XP_016060637
LinkDB
Position
Unknown
AA seq 267 aa
MPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHQGKAVFLARDKHHLSDICHLVRHDV
PYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVKCPLTEQGKQL
AIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGAIIADYAMSLLP
NMQTGKMAVLPGLSSTREKSEPDGCASAQGVAESIYTVNNGSTSSESEPELGEVRGSSAS
TKGPPPPTLPEPSYNINNRIASELKLQ
NT seq 804 nt   +upstreamnt  +downstreamnt
atgccagacaccttctcttatggtgggcatgaggacttttcaaaaatgatcgatgaagct
gagcccctgggctacccggtcgtggtgaagagcacacgaggacaccagggaaaagctgtc
ttccttgcaagagacaaacatcacctctcagacatctgccacctggtccgccacgatgtg
ccctacctgttccagaagtacgtgaaggagtcacatgggaaagatatccgggtggtggtg
gtcgggggccaggtgataggctctatgcttcgctgctccacagacggccggatgcagagc
aactgctctctcggtggtgtgggcgtcaagtgcccgctgacagaacaaggcaagcagttg
gctattcaggtgtccaacatcctgggcatggacttctgtggcattgatctcctcatcatg
gacgatggctccttcgtggtgtgtgaggcaaatgccaacgtgggtttcctcgccttcgac
caggcatgcaacttagacgtgggtgcaatcatcgcagactatgccatgtccttgctgcca
aatatgcagactgggaagatggccgtcctcccaggactgtctagtaccagggagaagagc
gagccagacggctgtgcttcagctcagggagttgcagagagcatctacaccgtcaacaat
gggtctacctctagcgagagtgagcctgaactgggagaggtccggggctcctcagcaagc
acgaaggggcccccgccccccacgctgcccgagcccagctacaacattaacaacaggatt
gcttccgaattaaaacttcagtga

DBGET integrated database retrieval system