KEGG   Miniopterus natalensis (Natal long-fingered bat): 107531294
Entry
107531294         CDS       T05883                                 
Symbol
CRYAB
Name
(RefSeq) alpha-crystallin B chain
  KO
K09542  crystallin, alpha B
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107531294 (CRYAB)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107531294 (CRYAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107531294 (CRYAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107531294 (CRYAB)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP20
   107531294 (CRYAB)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107531294 (CRYAB)
SSDB
Motif
Pfam: Crystallin HSP20
Other DBs
NCBI-GeneID: 107531294
NCBI-ProteinID: XP_016060818
LinkDB
Position
Unknown
AA seq 175 aa
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
IDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFVSREFHR
KYRIPADVDPLAITSSLSSDGVLSVNGPRKQASGPERTIPITREAKPAVTAAPKK
NT seq 528 nt   +upstreamnt  +downstreamnt
atggacatcgccatccaccacccctggatccgccgccccttctttcctttccactccccc
agccgcctctttgaccagttcttcggagagcacctgctggagtctgatctcttcccaact
tctacttccctgagccccttctacctgcggccaccgtcattcctgcgggcacccagctgg
attgacactgggctctcagagatgcgtctggagaaagacagattctctgtcaacctggac
gtgaagcacttctccccagaagaactcaaggtcaaggtgctgggagatgtgattgaggtg
catggcaaacacgaagagcgccaggatgaacacggtttcgtttcccgggagttccacagg
aaataccggatcccagcggatgtggaccctctcgccattacctcatccctgtcatctgat
ggggtcctcagtgtgaatggaccaaggaaacaggcctctggccctgagcgcaccattccc
atcactcgtgaagcgaagcctgctgtcactgcggcccccaagaagtag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107541250
Entry
107541250         CDS       T05883                                 
Symbol
CRYAA
Name
(RefSeq) alpha-crystallin A chain isoform X1
  KO
K09541  crystallin, alpha A
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107541250 (CRYAA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107541250 (CRYAA)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP20
   107541250 (CRYAA)
SSDB
Motif
Pfam: Crystallin HSP20
Other DBs
NCBI-GeneID: 107541250
NCBI-ProteinID: XP_016073749
LinkDB
Position
Unknown
AA seq 196 aa
MDVAIQHPWFKRALGAFYPSRLFDQFFGEGLFEYDLLPFLSSTVSPHYRQSLFRTALDSG
ISELMTHMWCVMHQPHAGGPKSNPAKVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIH
GKHNERQDDHGYISREFHRRYRLPANVDQSAVSCSLSADGMLTFSGPKVPSGLDLGHSER
AIPVSREEKPSSAPSS
NT seq 591 nt   +upstreamnt  +downstreamnt
atggacgtcgccatccagcacccctggttcaaacgtgccctgggcgccttctaccccagc
cggctgttcgaccagtttttcggggagggcctctttgagtacgacctgctgcccttcctg
tcctccaccgtgagcccccactaccgccagtccctcttccgcaccgcgctggactccggc
atctccgagctcatgacccacatgtggtgtgtaatgcaccaaccacatgccggaggcccc
aagagcaacccagccaaggtccggtctgaccgggacaagtttgtcatctttctggatgtg
aaacacttctccccggaggacctgacggtgaaggtgcaggaggacttcgtggagatccac
ggcaaacacaacgagaggcaggatgaccacggctacatctcccgcgagttccaccgccgc
taccgcctgcctgccaacgtggaccagtcggctgtctcctgctccctgtctgccgacggc
atgctgaccttctctggccccaaggtcccgtctggcctggatttgggccacagcgagcgc
gccatccccgtgtcgcgggaggagaagcctagctctgcaccctcgtcctaa

DBGET integrated database retrieval system