KEGG   Miniopterus natalensis (Natal long-fingered bat): 107531595
Entry
107531595         CDS       T05883                                 
Symbol
ATXN3
Name
(RefSeq) ataxin-3 isoform X1
  KO
K11863  Ataxin-3 [EC:3.4.22.-]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107531595 (ATXN3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107531595 (ATXN3)
   05022 Pathways of neurodegeneration - multiple diseases
    107531595 (ATXN3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107531595 (ATXN3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107531595 (ATXN3)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-
     107531595 (ATXN3)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C86
   107531595 (ATXN3)
Ubiquitin system [BR:mna04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    107531595 (ATXN3)
SSDB
Motif
Pfam: Josephin SUIM_assoc UIM
Other DBs
NCBI-GeneID: 107531595
NCBI-ProteinID: XP_016061200
LinkDB
Position
Unknown
AA seq 308 aa
MRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRID
PINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVV
KGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRGQKADPEQDSGPDDGPGAALEE
EELQRALALSRRQADAEDEEADLRRAIQLSMRGSSRNASQDSPQTSGTHLTSEELRKRRE
AYFEKQQQQHQQQQDPPGQLSPPCETPTPNSEALGSDLGGLSEEDMLQAAVTMSLETVRN
NFITEEKK
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaggatggccgaggggggcgtgacgagcgaggactaccgcacctttttacagcagcct
tctggaaatatggatgatagtgggtttttctctattcaagttataagcaatgccttgaaa
gtttggggtttagaactaatcctgttcaacagtccagagtatcagaggctcaggatcgat
cccataaatgaaagatcatttatatgcaattataaagaacactggtttacagttagaaaa
ttaggaaaacagtggttcaacttgaattctctcttgacgggtccagaattaatatcagac
acataccttgcacttttcttggctcaattacaacaggaaggttattctatatttgttgtt
aagggtgatctgccagattgtgaagctgaccaactcctacagatgatcagggtccaacag
atgcatcgaccaaaacttattggggaggaattggcacagctgaaggagcagagaggccag
aaggctgatccggagcaggactcgggcccggacgacgggccgggggcggcgctggaggag
gaggagctgcagcgggcgctggcgctcagccgccggcaggcggacgccgaggacgaggag
gccgacctccgccgggccatccagctcagcatgcgcggtagttccagaaatgcatctcaa
gatagtccacagacatcaggtacacatcttacttcagaagagctacgaaagagaagagaa
gcctactttgaaaagcagcagcagcagcatcaacaacagcaggatccaccaggacagctt
tcaccgccgtgtgaaacaccgaccccaaattcagaagcacttggcagtgatctaggtggt
ctgagtgaagaagacatgcttcaggcagcagtgaccatgtctttagaaactgttagaaat
aatttcataacagaagaaaaaaaataa

DBGET integrated database retrieval system