KEGG   Miniopterus natalensis: 107531658
Entry
107531658         CDS       T05883                                 

Definition
(RefSeq) myosin-7-like
  KO
K17751  myosin heavy chain 6/7
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04919  Thyroid hormone signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107531658
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107531658
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107531658
   04261 Adrenergic signaling in cardiomyocytes
    107531658
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107531658
   05414 Dilated cardiomyopathy
    107531658
   05416 Viral myocarditis
    107531658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107531658
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107531658
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N IQ AAA_22 Crescentin Filament
Other DBs
NCBI-GeneID: 107531658
NCBI-ProteinID: XP_016061248
LinkDB
Position
Unknown
AA seq 1842 aa
MGDAEMAIFGAAAPFLRKSDKERLEAQTRPFDLKKDVFVPDDKEEFVKAKVVSREGGKVT
AETENGKTVTVKEDQVLQQNPPKFDKLEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGL
FCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQNTGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKSERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDSEELMATDNAFDVLGFTPEEKNSIYKLTGAIMHFG
NMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
SYAIGALAKSVYEKMFNWMVTRINATLETKQQRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLVHYAGTVDYNILGWLQKNKDP
LNETVVGLYQKSSLKLLSNLFANYAAADAPADKGKGKAKKGSSFQTVSAVHRENLNKLMT
NLRCTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGSEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDEK
LSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLL
KSAETEKEMATMKEEFGRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEINERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL
TKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENAKQQLDERL
KKKDFELNALNARIEDEQALGGQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SRAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILAEWKQKYEESQSELESSQKESRSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSSGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILR
AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRIAAEAQKQVKSLQSLLKDTQIHLDDAVRVNDDLKENIAIVERRNNL
LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTE
VEEAVQECRNAXRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNL
SKFRKVQHELDEAEERADIAESQVNKLRAKSRDIGTKGLNEE
NT seq 5529 nt   +upstreamnt  +downstreamnt
atgggggatgcagagatggcaatatttggggccgctgcccccttcctgcgcaagtcagac
aaggagcggctggaagcccagaccaggccatttgacctcaagaaggatgtctttgtacct
gatgacaaagaagagttcgtcaaggccaaggttgtgtctcgagagggtggcaaagtcact
gccgagacagagaatggcaagacggtgacagtgaaggaggaccaggtgttgcagcagaac
ccgcccaagtttgacaagctcgaggacatggccatgctgaccttcctccacgagcccgcc
gtgctctataacctcaaggagcgctatgcggcctggatgatctatacctattcaggcctc
ttctgtgtcaccatcaacccctacaagtggctgccggtgtacaacgctgaggtggtggcc
gcctaccggggcaagaagaggagtgaggcgccgccccacatcttttccatctctgacaac
gcctatcagtacatgctgacagacagagaaaaccagtccatcctgattacaggagaatcc
ggggccgggaagacagttaacaccaagagggtcattcagtactttgctgttattgctgcc
attggagatcgcagtaagaaggaccagaacacaggcaagggcaccctggaggaccagatc
attcaggccaaccctgccctggaggctttcggcaatgccaagacggtccggaatgacaat
tcctcccgctttgggaaattcattcgaatccattttggggcgactggaaagttggcatct
gcagacatagagacttaccttctggaaaaatccagagttattttccagctgaaatcagag
agagattatcatattttctaccaaatcctgtctaataaaaagcctgagctgctggacatg
ctgctgatcaccaacaacccctatgattatgcattcatctcccaaggagagactactgtg
gcttcaattgatgactctgaggagctcatggccactgataatgcctttgacgtgctgggc
ttcactccagaggagaagaattctatttacaagctgactggtgccatcatgcactttgga
aacatgaagttcaaacagaagcagcgagaggagcaggctgagcctgacggcaccgaagag
gctgataagtctgcttatctcatggggttgaactcagccgacttgctcaaggggctgtgc
caccctcgggtgaaagtgggcaatgagtatgtcaccaaggggcagaatgtccagcaggtg
tcatatgccatcggggcactggccaagtcagtgtatgagaagatgttcaactggatggtg
acgcggatcaacgccaccctggagaccaagcagcagcgccagtacttcattggagtcctg
gacattgctggctttgagatcttcgacttcaacagcttcgagcagctctgcatcaacttc
accaacgagaagctgcaacagttcttcaaccaccacatgttcgtgctggagcaggaggag
tacaagaaggagggcatcgagtgggagttcatcgactttggcatggacctgcaggcctgc
atcgacctcattgagaagcccatgggcatcatgtccatcctggaggaggagtgcatgttc
cccaaggccactgatatgaccttcaaggccaagctgtatgacaaccacctaggcaagtcc
aacaacttccagaagcctcgcaatatcaagggaaagcaggaagcccacttctctctggtc
cactatgctggcactgtggactacaacatcttgggctggctgcagaagaacaaagaccca
ctcaatgagacggtggtgggcttataccagaagtcctccctcaagctgctcagcaacctg
tttgccaactatgctgctgctgatgcacctgctgataagggcaaaggcaaggccaagaaa
ggctcatcctttcagactgtgtcagccgtgcacagggaaaatctgaacaagctgatgacc
aacttgcgctgcacacacccccacttcgtgcgttgcatcatccccaatgagaccaagtct
ccaggagtgatggacaaccccctggtcatgcaccagctgcgctgcaacggcgtgctggag
ggcatccgcatctgcaggaagggcttccccaaccgcatcctctacggggacttcaggcag
aggtatcgcatcctcaacccagcagccatccctgaagggcagttcattgacagcagaaag
gggtcagagaagctgctgggctccctggacattgaccacaaccagtacaagtttggccac
accaaggtattcttcaaggcagggctgctggggctactggaggagatgcgagatgagaag
ctgagccgcatcatcacccgcatccaggcccagtctcgtggtgtgctctccaggatggag
ttcaagaagcttctggaacgcagagactccctgctgataatccagtggaacattcgggcc
ttcatgggggtcaagaactggccctggatgaaactgtactttaagatcaagcctctactg
aagagcgcagagacagaaaaggagatggccaccatgaaggaggagtttgggcgcctcaaa
gaggcgctggagaagtccgaggctcgccgcaaggagctggaggagaagatggtgtctctg
ctgcaggagaagaatgacctgcagctccaagtgcaggcggaacaagacaacttggccgat
gcagaagagcgttgtgaccagctgatcaagaacaagatccagctggaggccaaggtgaaa
gagataaatgagaggctagaggatgaggaggagatgaacgccgagctcactgccaagaag
cgcaaactggaagacgagtgctctgagctcaaaagggacattgatgacctggagctgacc
ctggccaaggtggagaaagagaagcatgcaacagagaacaaggtgaagaacctcacagag
gagatggctggactagacgagatcatcgccaaactgactaaggagaagaaagctctgcaa
gaggcccaccagcaggccctggatgaccttcaggctgaggaggacaaggttaacacactg
accaaggccaaggtcaagctggagcagcaggtggatgatctggaggggtctctggaacag
gagaagaaggtacgcatggacttggagcgagcaaagcggaagctggagggcgacctgaaa
ctgactcaggagagcatcatggatctggagaacgccaagcagcagctggatgagcggctg
aaaaagaaggactttgagctgaatgccctgaatgcaaggattgaggatgagcaggccctg
ggtggtcagctacagaagaagctcaaagagcttcaggcacgcatcgaggagctggaggag
gagctggaggctgagcgcactgcccgagccaaggtggagaagctgcgctcagacctgtcc
cgggagctggaggagatcagcgagcggctggaagaggctggcggggccacgtctgtgcag
attgagatgaacaagaagcgtgaggctgagttccagaagatgaggcgggacctggaggag
gccactctgcagcacgaggccacggcagcggccctgcgcaagaagcatgctgacagtgtg
gccgagctgggcgagcagattgacaacctgcagcgtgtgaagcagaagctggagaaggag
aagagtgagttcaagctggagctggacgatgtcacctccaacatggagcagatcatcaag
gccaaggctaacctggagaaaatgtgccggaccttggaagaccagatgaatgagcaccgg
agcagagctgaggagacccagcgttctgtcaatgacctcaccagccagcgggccaagctg
cagactgagaatggtgagctgtcccgccagctggatgagaaggaggcgctgatctcccag
ctgacccgaggcaagctcacctacacccagcagctggaggacctcaagcggcagctggag
gaggaggttaaggcgaagaatgccctggcccacgcactgcagtcggcccggcacgactgc
gacctgctccgcgagcagtacgaggaggagacggaggccaaggcggagctgcagcgagtc
ctgtccaaggccaactcggaggtggcccagtggaggaccaagtatgagacggacgccatc
cagcggaccgaggagctcgaggaggccaagaagaagctggcccagcggctgcaggatgct
gaggaggccgtggaggccgtcaacgccaagtgctcatccctggagaagaccaagcaccgg
ctgcagaacgagatcgaggacctgatggtggacgtggagcgctccaacgcggctgccgca
gccctggacaagaagcagaggaacttcgacaagatcctggctgaatggaagcagaagtac
gaggagtcgcagtcggagctggagtcctcacagaaggagtcgcgctctctcagcaccgag
ctcttcaagctcaagaacgcctatgaggagtccctggagcacctggagaccttcaagagg
gaaaacaagaacctccaggaggagatctcggacctgactgagcagttgggttccagtgga
aagagtatccatgagctggagaagatccgcaagcagctggaggccgagaagctggagttg
cagtcggccctggaggaggcggaggcctccctggagcacgaggagggcaagatcctccgg
gcccagctggagttcaaccagatcaaggccgagatcgagcggaagctggctgagaaggac
gaggagatggagcaggccaagcgcaaccacctgcgggtggtggactcgctgcagacctcc
ctggacgcagagacgcgcagccgcaacgaggccctgcgtgtgaagaagaagatggagggc
gacctcaatgagatggaaatccagctcagccatgccaaccgcatagctgctgaggcccag
aaacaagtcaagagcctccagagcttgctgaaggacacccagatccatctggacgacgca
gtccgggtcaatgatgacctgaaggagaacatcgccatcgtggagcggcgcaacaacctg
ctgcaggcggagctggaggagctgcgggccgtggtggagcagaccgagaggtctcggaag
ctggcggagcaggagctgatcgagaccagcgagcgagtgcagctgctgcactcccagaat
accagcctcatcaaccagaagaagaagatggatgcagacctgtctcagcttcagaccgaa
gtggaggaggcagtgcaggaatgcaggaacgctgngcgcatcaaggagctcacctaccag
acggaggaggacaggaagaatctgcttcggctgcaggacctggtggacaagctgcagctg
aaggtcaaggcctacaagcgccaggcagaggaggcggaggagcaggccaacaccaacctg
tccaagttccgcaaggtgcagcatgaactggatgaggcagaggagcgggcggacatcgct
gagtcccaggtcaacaagttgcgggccaagagccgtgacatcggcaccaagggcttgaat
gaggagtag

KEGG   Miniopterus natalensis: 107531708
Entry
107531708         CDS       T05883                                 

Gene name
MYH6
Definition
(RefSeq) myosin-6 isoform X1
  KO
K17751  myosin heavy chain 6/7
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04919  Thyroid hormone signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107531708 (MYH6)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107531708 (MYH6)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107531708 (MYH6)
   04261 Adrenergic signaling in cardiomyocytes
    107531708 (MYH6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107531708 (MYH6)
   05414 Dilated cardiomyopathy
    107531708 (MYH6)
   05416 Viral myocarditis
    107531708 (MYH6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107531708 (MYH6)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107531708 (MYH6)
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Filament IQ Crescentin AAA_22 AAA_16
Other DBs
NCBI-GeneID: 107531708
NCBI-ProteinID: XP_016061324
LinkDB
Position
Unknown
AA seq 1939 aa
MSDAQMADFGAAAEYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKIVSREGGKVT
AETENGKTVTLKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFASIAAIGDRGKKDNPNANKGTLEDQIIQANPALEAFGNAKTVRND
NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD
MLLITNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLGFTAEEKAGVYKLTGAIMHY
GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ
VYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECM
FPKATDMTFKAKLYDNHLGKSNNFQKPRNVKGKQEAHFSLVHYAGTVDYNILGWLEKNKD
PLNETVVGLYQKSSLKLMATLFSSYAAADAGDSSKSKGGKKKGSSFQTVSALHRENLNKL
MANLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
RQRYRILNPAAIPEGQFIDSRKGSEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD
ERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP
LLKSAETEKEMANMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL
NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE
LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVN
TLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE
KLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSD
LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD
SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE
YRTKLEEAQRSLNDFTTQQAKLQTENGELSRQLEEKEALISQLTRGKLSYTQQMEDLKRQ
LEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD
AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA
AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF
KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKI
LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKM
EGDLNEMEIQLSQANRIASEAQKHLKIAQAHLKDTQIQLDDSVRANDDLKENIAIVERRN
NLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ
SEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD
EAEQIALKGGKKQLQKLEARVRELENELEAEQKRNVESVKGMRKSERRIKELTYQTEEDK
KNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN
KLRAKSRDIGTKQKMHDEE
NT seq 5820 nt   +upstreamnt  +downstreamnt
atgagtgatgcccagatggctgactttggggcggcagccgagtacctccgcaagtcggag
aaggagcgtctagaggcccagacccggcccttcgacatccgcactgaatgctttgtgcct
gatgacaaagaggagttcgtcaaggccaagatcgtatccagggaggggggcaaggtcact
gcggagaccgagaacggcaagacggtgaccctgaaggaggaccaggtgatgcagcagaac
ccgcccaagttcgacaagatcgaggacatggccatgctgaccttcctccacgagcccgcc
gtgctcttcaacctcaaggagcgctatgcggcctggatgatctacacctactcaggcctc
ttctgcgtcaccgtcaacccctacaagtggctgccagtgtacaacgctgaggtggtggcc
gcctaccggggcaagaagaggagtgaggcgccgccccacatcttttccatctctgacaac
gcctatcagtacatgctgacagatcgggagaaccagtccatcctcatcaccggagaatcc
ggggctgggaagactgtgaacacgaaacgtgtcatccagtattttgccagcatcgcagcc
ataggtgaccgtggcaagaaggacaatcccaatgcaaacaagggcaccctggaggaccag
atcatccaggccaaccctgccctggaggccttcggcaacgccaagactgttcggaatgac
aactcctcccgatttgggaaattcatcaggatccactttggggccactggaaagttggct
tctgcagacatagagacctatctcctagagaagtcccgggtgatcttccagctcaaggct
gagaggaactatcacatcttctaccagatcctgtccaacaagaagccagaactgctggac
atgctgctgatcaccaacaacccctacgactatgccttcgtgtctcagggagaggtgtct
gtggcttccatcgacgactccgaggagctcttggccacagacagcgcctttgacgtgctg
ggcttcactgctgaggagaaagctggcgtctacaagctgacgggtgccatcatgcactac
ggaaacatgaagttcaagcagaagcagcgggaggagcaggccgagcccgacggcaccgaa
gatgccgataagtctgcctacctcatgggactaaactcagccgacctgcttaaggggctg
tgccaccctcgggtgaaagtgggcaatgagtatgtcaccaagggacagagcgtgcagcag
gtgtactactccatcggggcactggccaagtcagtgtatgagaagatgttcaactggatg
gtgacacggatcaacgccaccctggagaccaagcagccgcgccagtacttcattggagtc
ctggacattgctggctttgagatcttcgacttcaacagctttgagcagctctgcatcaac
ttcaccaacgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcaggag
gagtacaagaaggagggcatcgagtgggagttcatcgactttggcatggacctgcaggcc
tgcatcgacctcattgagaagcccatgggcatcatgtccatcctggaggaggagtgcatg
ttccccaaggccactgacatgaccttcaaggccaagctgtatgacaatcacctgggcaag
tccaacaacttccagaagcctcgcaatgtcaaggggaagcaggaagcccacttctctctg
gtccactatgctggcaccgtggactacaacatcctcggctggctggagaagaacaaagac
ccactcaatgagacggtggtgggcttataccagaagtcctccctcaagctcatggccaca
cttttctcctcatatgctgccgctgatgcaggggatagcagtaaaagcaaaggaggcaag
aaaaagggctcatcctttcagacggtgtcagccctccaccgggaaaatctgaacaagctg
atggccaacctgaagaccacccaccctcacttcgtgcgctgcattatccccaatgaacgg
aaggctccgggagtgatggacaaccccctggtcatgcaccagctgcgctgcaacggcgtg
ctggagggcatccgcatctgcaggaagggcttccccaaccgcatcctctatggggacttc
aggcagaggtatcgaatcctcaacccagcagccatccctgaagggcagttcattgacagc
agaaaggggtcagagaagctgctgggctccctggacattgaccacaaccagtacaagttt
ggccacaccaaggtattcttcaaggcagggctgctggggctactggaggagatgcgagat
gagaggctgagccgcatcatcacccgcatccaggcccaggcccggggccagctcatgcgc
attgagttcaagaagattgtggagcgcagggatgctcttctggtaatccagtggaacatt
cgggccttcatgggggtcaagaactggccctggatgaaactgtactttaagatcaagcct
ctactgaagagcgcagagacagagaaggagatggcgaacatgaaggaggagtttgggcgc
atcaaagagacactggagaagtccgaggctcgccgcaaggagctggaggagaagatggtg
tccctgctgcaggaaaagaatgatctgcagctccaagtgcaggcggaacaagacaacctc
aatgatgcagaggaacgctgtgaccagctgatcaagaacaagatccagctggaggccaag
gtgaaggagatgaatgagaggctggaggacgaggaggagatgaacgccgagcttaccgcc
aagaagcgcaagctggaagacgagtgctctgagctcaagaaggatattgatgacctggag
ctgaccctggccaaggtggagaaagagaagcatgcaacagagaacaaggtgaagaacctc
acagaggagatggctgggctggatgagatcatcgccaaactgactaaggagaagaaagct
ctgcaagaggcccaccagcaggccctggatgaccttcaggctgaggaagacaaggtcaac
acactgaccaaatctaaagtcaagctggagcaacaggtggatgatctggagggatccctg
gagcaggagaagaaagtgcgcatggacctggagcgagcaaagaggaagctggagggtgac
ctgaagctgacccaggagagcatcatggacctagagaatgacaagctgcagctggaagaa
aagctcaagaagaaggagtttgacattagtcagcagaacagtaagattgaggatgagcag
gcactggcccttcagctgcagaagaaactgaaggaaaaccaggcacgcatcgaggagctg
gaggaggagctggaggctgagcgcactgcccgagccaaggtggagaagctgcgctcagac
ctgtcccgggagctggaggagatcagcgagcggctggaagaggctggcggggccacgtct
gtgcagattgagatgaacaagaagcgtgaggctgagttccagaagatgaggcgggacctg
gaggaggccactctgcagcacgaggccacggcagcggccctgcgcaagaagcatgctgac
agtgtggccgagctgggcgagcagattgacaacctgcagcgtgtgaagcagaagctggag
aaggagaagagtgagttcaagctggagctggacgatgtcacctccaacatggagcagatc
atcaaggccaaggcaaacctggagaaggtgtctcggacattggaggatcaggccaacgag
taccgcactaagctggaggaggcccaacgctccctcaacgatttcaccacgcagcaagcc
aagctgcagacggagaatggcgagctgtcccggcaactggaagaaaaggaggcacttatc
tcccagctgacccgagggaaactctcctacacccagcaaatggaggacctcaagaggcag
ctggaggaggagggcaaggcgaagaacgccctggcccacgcactgcagtcggcccggcac
gactgcgacctgctccgcgagcagtacgaggaggagacggaggccaaggcggagctgcag
cgagtcctgtccaaggccaactcggaggtggcccagtggaggaccaagtatgagacggac
gccatccagcggaccgaggagctcgaggaggccaagaagaagctggcccagcggctgcag
gatgctgaggaggccgtggaggccgtcaacgccaagtgctcatccctggagaagaccaag
caccggctgcagaacgagatcgaggacctgatggtggacgtggagcgctccaacgcggct
gccgcagccctggacaagaagcagaggaacttcgacaagatcctggctgaatggaagcag
aagtacgaggagtcgcagtcggagctggagtcctcacagaaggaggcgcgctctctcagc
accgagctcttcaagctcaagaacgcctatgaggagtccctggagcacctggagaccttc
aagagggaaaacaagaacctccaggaggagatctcggacctgactgagcagctgggagaa
ggaggaaagaatgtgcatgagctggagaaggtccgcaagcagctggaggtggagaaactg
gagttgcagtcggccctggaggaggctgaggcctccctggagcatgaggagggcaagatc
ctccgggcccagctggagttcaaccagatcaaggccgagatcgagcggaagctggctgag
aaggacgaggagatggagcaggccaagcgcaaccacctgcgggtggtggactcgctgcag
acctccctggacgcagagacgcgcagccgcaacgaggccctgcgtgtgaagaagaagatg
gagggcgacctcaatgagatggaaatccagctcagccaggctaacaggatagcctcagag
gcccagaagcacctgaagattgcccaagcccatctaaaggatacccagatccagttggac
gattcagttcgggccaacgatgacctgaaggagaacatcgccatcgtggagcggcgcaac
aacctgctgcaggccgagctggaggagctgcgggccgtggtggagcagacagagaggtct
cggaagctggcggagcaggagctgatcgagaccagtgagcgggtgcagctgctgcactcc
cagaacaccagcctcatcaaccagaagaagaaaatggagtcggacctgacccagctccag
tcagaagtggaggaggcagtgcaggagtgcagaaacgctgaggagaaggccaagaaggcc
atcacagacgccgccatgatggcggaggagctgaagaaggagcaggacaccagcgcccac
ctggagcgcatgaagaagaacatggagcagaccatcaaggacctgcagcaccggctggac
gaggccgagcagatcgccctcaaggggggcaagaagcagctgcagaagctggaggcccgg
gtgcgggagctggagaatgagctggaggccgagcagaagcgcaacgtggagtcagtcaag
ggcatgaggaagagcgagcggcgcatcaaggagctcacctaccagacggaagaggacaag
aagaacctgctccggctgcaggacctggtggacaagctgcagctgaaggtcaaggcctac
aagcgccaggccgaggaggcggaggagcaggccaacaccaacctgtccaagttccgcaag
gtgcagcatgaactggatgaggcagaggagcgggcggacatcgctgagtcccaggtcaac
aagctgcgggccaagagccgtgacatcggcaccaagcagaaaatgcacgatgaggaatga

DBGET integrated database retrieval system