KEGG   Miniopterus natalensis: 107531724
Entry
107531724         CDS       T05883                                 

Symbol
IRF9
Name
(RefSeq) interferon regulatory factor 9 isoform X1
  KO
K04693  interferon regulatory factor 9
Organism
mna  Miniopterus natalensis
Pathway
mna04217  Necroptosis
mna04380  Osteoclast differentiation
mna04621  NOD-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna05160  Hepatitis C
mna05162  Measles
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05171  Coronavirus disease - COVID-19
mna05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107531724 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107531724 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107531724 (IRF9)
   04625 C-type lectin receptor signaling pathway
    107531724 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107531724 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107531724 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107531724 (IRF9)
   05171 Coronavirus disease - COVID-19
    107531724 (IRF9)
   05164 Influenza A
    107531724 (IRF9)
   05162 Measles
    107531724 (IRF9)
   05168 Herpes simplex virus 1 infection
    107531724 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107531724 (IRF9)
   05169 Epstein-Barr virus infection
    107531724 (IRF9)
   05165 Human papillomavirus infection
    107531724 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107531724 (IRF9)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    107531724 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 107531724
NCBI-ProteinID: XP_016061354
LinkDB
Position
Unknown
AA seq 426 aa
MLPTALIPRMASGRARCTRKLRSWVVEQVESGQFPGVCWEDAAKTMFRIPWKHAGKQDFR
EDQDAAFFKAWAIFKGKYKEGDTEGPAIWKTRLRCALNKSSEFEEVPENSHRDGAEPYKV
YRLLPPGTFPAPPATQKSPSKRHHSCVSPEREEDEDTTKNCILSPSLPQDPLKNKVEANG
GTGHSGFGSSSSSSSNSSNSNSPEPQEGVNTNEAPFQEDPVTLELLPPPDSDYSLMLTFI
YNGHVVGEAQVQSLDCRLVAEPSSSQYSMEQVVFPKPGPQEPTQRLLSQLERGVLVASNS
RGLFVQRLCPIPISWSAPHAPPGPGPHLLPSNKCVELFKTSHFCRDLERYFRGLGPPPKF
QVTLNFLEEYPGPSHTPQSLISVQMEQAFARQLLAERPEDQAATMSLLQSLGDLPSSSPP
YSSCFL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgctgcctactgctcttattcccaggatggcatcaggccgggcgcgctgcaccagaaag
ctccggagctgggtagtggagcaagtggagagtggacagttcccaggggtgtgctgggaa
gatgcagctaagactatgttccggattccctggaagcatgcaggcaagcaggacttccgg
gaggaccaggatgctgccttcttcaaggcctgggcaatatttaagggaaagtacaaggag
ggggacacggaaggccccgctatctggaagactcgtttgcgctgtgctctcaacaagagt
tctgaatttgaggaagttcctgagaatagccatagagatggggctgagccctacaaggtg
tatcgactgctgccaccaggaaccttccctgccccaccagcaacccagaaatcaccatca
aagagacaccacagctgtgtgtcccctgagagggaagaggatgaggataccacaaagaac
tgtatactcagtccctccttgccccaggaccccctcaaaaacaaggtggaggccaatgga
ggaacaggccattcaggctttggaagtagcagcagcagcagcagcaacagcagcaacagc
aacagtcctgagcctcaggaaggtgtaaacacaaatgaggcccctttccaagaagatccg
gtgactctggagcttctgccccctccagactcagactactccctgatgctcaccttcatc
tacaatgggcatgtggtgggtgaggcccaggtgcagagcctggactgccgactcgtggct
gagccctccagctcccagtacagcatggagcaggtggtgtttcccaagcctggcccgcaa
gaacccacccagcgcctgctgagccagctcgagagaggtgtcctggtggctagcaactcc
cgaggcctcttcgtgcagcgcctttgtcccatccccatctcctggagcgcaccccatgcc
ccacctggtccaggcccgcatctgctgcccagcaacaagtgtgtggagctcttcaaaacc
tcccacttctgcagagacttggagaggtacttccggggcctgggccccccaccgaagttc
caggtgacactgaatttcttagaggagtaccctgggcccagccacaccccacagagtctt
atctcagttcagatggagcaggcctttgcccgacaattactggcggagcgtccagaggac
caggcagccactatgtccctgttgcagagcctgggagacctaccttcctcctctccgccc
tattcttcctgttttctttga

DBGET integrated database retrieval system