KEGG   Miniopterus natalensis: 107532553
Entry
107532553         CDS       T05883                                 

Gene name
CXCL12
Definition
(RefSeq) stromal cell-derived factor 1
  KO
K10031  C-X-C motif chemokine 12
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04360  Axon guidance
mna04670  Leukocyte transendothelial migration
mna04672  Intestinal immune network for IgA production
mna04810  Regulation of actin cytoskeleton
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107532553 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107532553 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107532553 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107532553 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107532553 (CXCL12)
   04672 Intestinal immune network for IgA production
    107532553 (CXCL12)
   04062 Chemokine signaling pathway
    107532553 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    107532553 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532553 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107532553 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107532553 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107532553 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107532553 (CXCL12)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Chemokines
   107532553 (CXCL12)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Chemokines
   107532553 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107532553
NCBI-ProteinID: XP_016062451
LinkDB
Position
Unknown
AA seq 83 aa
MATLYLSPPAGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVAKLKSNNRQV
CIDPKLKWIQEYLDKALNKRLKM
NT seq 252 nt   +upstreamnt  +downstreamnt
atggccaccttgtacttgtcacctcctgcagggaaaccggtcagcctgagctacagatgt
ccttgccgattcttcgagagccacgttgcaagagccaacgtcaagcatctcaaaatcctc
aacactccaaactgtgcccttcagatcgtggccaagctgaagagcaacaaccgccaagtg
tgcattgacccgaaactgaagtggattcaggaatacctggataaagctttaaacaagagg
ctcaagatgtga

DBGET integrated database retrieval system