KEGG   Miniopterus natalensis: 107532587
Entry
107532587         CDS       T05883                                 

Gene name
SGCB
Definition
(RefSeq) beta-sarcoglycan
  KO
K12566  beta-sarcoglycan
Organism
mna  Miniopterus natalensis
Pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107532587 (SGCB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107532587 (SGCB)
   05414 Dilated cardiomyopathy
    107532587 (SGCB)
   05416 Viral myocarditis
    107532587 (SGCB)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF1080
Other DBs
NCBI-GeneID: 107532587
NCBI-ProteinID: XP_016062504
LinkDB
Position
Unknown
AA seq 297 aa
MREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVIVLLFILAVINLI
ITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGNN
QPIVFQQGTTKLSVEQNKTSVTSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQ
KASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELKAENSIILNGTV
VVSTTRLPSSSSGDQFGAGEWVRYKLCMCADGTLFKVQVTGQNMGCQVSDHPCGNTH
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcgtgagaaggctgttgagaggaggaatgtcaataaagagcacaatagtaacttcaaa
gccggatatattccgattgatgaagatcgcctccataaaacaggcttgagagggagaaag
ggcaacttagccatctgtgtgattgtcctcttgttcatcctggctgtcatcaacttaatt
ataacacttgttatctgggctgtgattcgcattggaccgaatggctgtgacagcatggag
tttcatgaaagtggtctgctgcgatttaagcaagtatctgacatgggagttatacatcct
ctttataagagcacagtaggaggaaggcgaaatgagaatttggtcatcactggcaacaac
cagcctattgtttttcagcaagggacaacaaaactcagtgtggaacagaacaaaacctct
gttacaagtgacattggaatgcagtttttcgacccaagaactcaaaatattttattcagc
acagactatgaaactcatgagtttcatttgccaagtggagtgaaaagtttgaatgttcaa
aaggcatctactgaaaggattaccagcaatgctactagtgatttaaatataaaagttgat
ggacgtgctatagtgcgtggaaatgaaggagtgttcattatgggcaaaaccattgaattt
cacatgggtggtaatatggagttaaaagcagaaaacagcatcatcctaaatggaactgtg
gtggttagcacaactcgcctacctagttcctccagtggggaccagtttggtgctggcgaa
tgggtgcgctacaagctctgtatgtgtgccgacgggactctcttcaaagtacaagtaacg
ggccagaacatgggctgccaagtctcagaccacccctgtgggaacactcattag

DBGET integrated database retrieval system