KEGG   Miniopterus natalensis: 107532929
Entry
107532929         CDS       T05883                                 

Gene name
CD34
Definition
(RefSeq) hematopoietic progenitor cell antigen CD34
  KO
K06474  CD34 antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107532929 (CD34)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107532929 (CD34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107532929 (CD34)
CD molecules [BR:mna04090]
 Proteins
  107532929 (CD34)
SSDB
Motif
Pfam: CD34_antigen
Other DBs
NCBI-GeneID: 107532929
NCBI-ProteinID: XP_016062950
LinkDB
Position
Unknown
AA seq 387 aa
MAEKLSFHHGLRAEPELFVSRLCHLLTNVGSSGFTNADNFTTVATKSPTALIPSTVSTNV
PSQETITPSTHENTTHHSVFQDSKGTTATISEPTSNFTSTSEITTVPENVNSSVQTQTSL
ASTVSSTLTNFSTSEMTLKPSVSPGNISDPTYNNTSPVTYTIKPYASFSSTPSTIKGEIK
CSKVKEVKLAQAICLERNETSSCEDFKKDSGEKLIQVLCEKDQAEAGAGVCSLLLAQSEV
RPQCLLLVLPNRTELSSKLQLLKSHQPDLRKLGIQGLTEQNVGSHQSYSRKTLIALVTTG
ILLAVLGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGASPEAQGKASVNRG
AQENGTGQATSRNGHSARQQAVADTEL
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcggagaagctttccttccatcatggcttgagagcagagcctgagctctttgtctcc
aggctctgccaccttcttaccaacgtaggctcctctggattcacaaatgcagataacttt
actactgttgccacgaagtcacctactgcattgataccttcgactgtttctacaaatgta
cccagccaggaaaccataacaccaagtactcatgaaaataccacccaccactctgtcttt
caggacagcaaggggaccacagcaaccatctcagagcctacatccaactttacatctacc
tctgagatcaccacagttcctgaaaacgtgaattcttctgtccagacacagacctcttta
gccagcacagtgtcttccaccctaaccaacttttcaacttcagagatgaccttgaagccc
agcgtgtcacctggaaatatttcagaccccacatacaataacaccagtcctgtgacatat
accattaaaccctacgcatcgttttcttctaccccaagtaccattaagggagaaatcaaa
tgttccaaagtcaaagaagtgaaattggcccaagctatctgcctggagcgcaatgagacc
tccagctgtgaggactttaagaaggacagtggagagaaactgatccaagtcctgtgcgag
aaggaccaggccgaggctggggccggcgtgtgctccctgctccttgcccagtctgaggtg
aggcctcagtgcctgctgctggtcctgcccaacagaacagaactttccagcaagctccaa
cttctgaaaagtcaccagcctgacttgagaaagctggggatccaaggcctcacggaacaa
aatgttgggagccaccagagctattcccgcaagactctgattgcactggtcaccacgggg
atcctgctggctgtcttgggcactactggctacttcctgatgaaccgccgcagttggagc
cccacaggagaaaggctgggcgaagacccttattacacggagaacggtggaggccagggc
tatagctcaggccctggggcctcccctgaggctcagggaaaggccagtgtgaaccgaggg
gctcaggagaacgggaccggacaggccacatccagaaacggccattcagcgagacaacag
gcggtggctgataccgaattgtga

DBGET integrated database retrieval system