KEGG   Miniopterus natalensis (Natal long-fingered bat): 107533169
Entry
107533169         CDS       T05883                                 
Symbol
DERL1
Name
(RefSeq) derlin-1
  KO
K11519  Derlin-1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107533169 (DERL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107533169 (DERL1)
   05022 Pathways of neurodegeneration - multiple diseases
    107533169 (DERL1)
SSDB
Motif
Pfam: DER1 ActD
Other DBs
NCBI-GeneID: 107533169
NCBI-ProteinID: XP_016063234
LinkDB
Position
Unknown
AA seq 251 aa
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYFVLWPEAFLYRFQIWRPITATF
FFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG
HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH
NWGQGFRLGDQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtcggacatcggggactggttcaggagcatcccggctatcactcgctattggttcgcc
gccaccgtcgcggtgcccttggtcggcaaactcggtctcatcagcccggcctacttcgtc
ctctggcccgaagcatttctctaccgcttccagatttggagaccaatcactgccaccttt
tttttccctgtgggtccaggaaccggatttctttatttggtcaatttatatttcttatat
cagtattctacacgacttgaaacaggagcttttgatgggaggccagcagactatttattc
atgctcctctttaactggatttgcatcgtcattactggcttagcaatggacatgcagttg
ctgatgattcctctgataatgtcggtgctttatgtctgggcccagctgaacagagacatg
attgtgtcgttttggttcggaacacgatttaaggcctgttatttaccttgggttatcctt
ggattcaactatatcatcggaggctcggtaatcaatgagctaattggaaatctggttgga
catctttacttcttcctaatgttcagataccctatggatttaggaggaagaaattttctt
tccacaccccagtttttgtaccgctggctgcccagcaggagaggaggagtgtcaggattt
ggtgtgccccctgctagcatgaggcgagctgctgatcagaatggtggaggcggcagacac
aactggggacagggctttcgacttggggaccagtga

DBGET integrated database retrieval system