KEGG   Miniopterus natalensis: 107533233
Entry
107533233         CDS       T05883                                 

Gene name
ACP5
Definition
(RefSeq) tartrate-resistant acid phosphatase type 5
  KO
K14379  tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00740  Riboflavin metabolism
mna01100  Metabolic pathways
mna04142  Lysosome
mna04380  Osteoclast differentiation
mna05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    107533233 (ACP5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107533233 (ACP5)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107533233 (ACP5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    107533233 (ACP5)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     107533233 (ACP5)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107533233
NCBI-ProteinID: XP_016063313
LinkDB
Position
Unknown
AA seq 328 aa
MDTRTVLLVLQALLVLPLADGTAPTLRFVAVGDWGGVPNAPFYTARETANAKEIARTAKI
LGTDFILSLGDNFYFTGVQDANDKRFQETFEDVFSAPSLRNVPWYVLAGNHDHLGNLSAQ
IAYSKISKRWNFPSPYFRLHFKIPRSNVTVAIFMLDTVTLCGNSDDFLSQQPQRPRDPNL
ARTQLSWLKKQLAVAKEDYLLVAGHYPVWSIAEHGPTHCLVRQLQPLLTTYKVTAYLSGH
DHNLQYLEDENGIGYILSGAGNFMDPSKRHFRKVPSGYLRFHYGVENSLGGFAYIEISPK
EMSITYIEASGKSLFKTKLPRRARPERL
NT seq 987 nt   +upstreamnt  +downstreamnt
atggacacaaggacagtgctactcgtcctgcaagccttgctggtgctccccctggctgat
ggcactgctcccaccctgcgttttgtggctgtgggtgactggggaggggtccccaatgcc
ccattttacacagcccgggaaacagccaatgccaaggagattgccaggactgcgaagatc
ctaggcacagacttcatcctgtcactgggagacaatttttactttactggcgtgcaggat
gccaacgacaagagattccaggagaccttcgaggatgtgttctctgccccctccctccgc
aacgtgccctggtatgtgctggctggcaaccatgaccatctgggcaacctttcagcacaa
atcgcctactccaagatctccaagcgctggaatttccccagcccttacttccgcctgcac
ttcaagatcccacggtccaatgtgactgtggccatcttcatgctggatacagtgacattg
tgtggcaactcggatgacttcctcagccagcagccacagaggccccgtgacccaaatttg
gcccgtacacagctgtcctggctcaagaaacagctggcagtggccaaagaggactacttg
ctggtggctggccactacccagtgtggtccattgctgagcatgggcccacccactgtctg
gtccgtcaactgcagccactactgaccacatacaaggtcactgcctacctgagtggccat
gaccacaacctgcagtaccttgaggatgagaatggcatcggctacatactgagtggggct
gggaacttcatggacccctcgaagaggcactttcgcaaggttcccagcggctacctgcgc
ttccactatggggttgagaactcactgggtggcttcgcctacatagagatcagtcccaaa
gagatgagcatcacttacatcgaggcctcgggcaaatccctcttcaagaccaaactgcca
aggcgtgccaggcctgagcgtttgtga

DBGET integrated database retrieval system