KEGG   Miniopterus natalensis (Natal long-fingered bat): 107533274
Entry
107533274         CDS       T05883                                 
Symbol
PRKCSH
Name
(RefSeq) glucosidase 2 subunit beta
  KO
K08288  protein kinase C substrate 80K-H
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107533274 (PRKCSH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107533274 (PRKCSH)
Lectins [BR:mna04091]
 P-type lectins
  107533274 (PRKCSH)
SSDB
Motif
Pfam: PRKCSH-like PRKCSH_1 PRKCSH EF-hand_5 Ldl_recept_a EF-hand_1 EF-hand_6
Other DBs
NCBI-GeneID: 107533274
NCBI-ProteinID: XP_016063361
LinkDB
Position
Unknown
AA seq 532 aa
MLLLVLLLPVCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSTTIPFDQVNDDYCDCKDG
SDEPGTAACPNGSFHCTNTGYRPLYISSRWVNDGVCDCCDGTDEYNSGIVCENTCKEKGR
KERETLQQMAEVTREGFRLKKILIEDWKQAREEKQQKLTELQARKKSLEDQVEMLRMVKE
EAEKPEKEAKDRHQKLWEEQQAASKAQREQELAVSAFQELDDNMDGVVSVAELQTHPELD
TDGDGALSEGEAQTLLGGDTQMDPTSFQDHLWAAIKDKYQSEVLPTSPPAPSVPDLMEPK
EEQPLAPPQPMEEEEEEEEGETEEEEEEEEEDFQVQGEQPKEAPPPLTPPQPASPTEDKM
PPYDEQTQALIDAAQEARNKFEEAERSLRDMEESIRNLEQEISFDFGPSGEFAYLYKQCY
ELTTNEYVYRLCPFKLVSQQPKLGGSPTNLGTWGSWAGPEHDKFSAMKYEQGTGCWQGPN
RSTTVRLLCGKETVVTSTTEPSRCEYLMELMTPAACQEPPSEPPADSDHDEL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgttactgttggtgctgctgctccccgtgtgctgggccgtggaggtcaagcggccccgg
ggcgtctccctcaccaaccatcacttctacgatgagtccaagcctttcacttgtctggat
ggctccaccaccatcccttttgatcaggtcaacgatgactactgtgactgcaaagatggt
tccgatgagccaggaacagctgcttgtcctaacggcagcttccactgcaccaacactggc
tacaggcccctgtacatctcctccagatgggtcaacgatggggtttgtgactgctgcgat
gggacagacgagtacaatagtgggatcgtctgtgagaacacttgcaaagagaagggccgc
aaggaaagagagacattgcagcagatggcagaggttacccgcgaggggttccgcctgaag
aagatccttattgaggactggaagcaggcccgagaagagaagcagcaaaagctcactgag
ctacaggccagaaagaagtccctggaagaccaggtggagatgctacggatggtgaaggag
gaggctgagaagccagagaaggaggctaaagaccggcaccagaagctctgggaagagcag
caggccgcctccaaggcccaacgggagcaagagctggcagtcagcgccttccaggagctg
gatgacaacatggacggggtggtctcagtggccgagctgcagactcacccagagctggac
acagatggggatggggccctatcagaaggggaagcccagaccctgcttgggggagacacg
cagatggaccctacctccttccaagaccacctctgggctgccatcaaggacaagtaccag
tctgaggttctgcccaccagcccgccagcaccttctgtgcctgacctgatggagcctaag
gaagagcagcccctggcgcccccacagcccatggaagaggaggaggaggaggaagaaggg
gagacagaggaggaggaggaagaggaggaggaggatttccaggtgcagggggagcagccc
aaggaggcaccacccccacttacacccccccagccagccagccccaccgaggacaaaatg
ccaccctacgatgagcagacacaggcccttattgacgctgcccaggaggcccgcaacaag
tttgaggaggccgaacggtccttaagggacatggaagagtccatcaggaacctggagcag
gagatttcctttgatttcggccccagtggggagtttgcctacctgtacaaacagtgctac
gaactcaccactaatgagtacgtctaccggctctgtcccttcaagcttgtgtcacagcaa
cccaagctcggcggctctcccaccaacctcggcacctggggctcgtgggccggccctgaa
cacgacaagtttagcgccatgaagtatgaacagggcactggctgctggcagggccccaat
cgctctaccactgtgcgcctgctgtgtgggaaggagacagtggtgaccagcaccacggag
cccagtcgctgcgagtacctcatggagctgatgacgcctgctgcctgccaagagccaccc
tccgaaccccctgcagacagtgaccatgatgagctctag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107543105
Entry
107543105         CDS       T05883                                 
Symbol
GANAB
Name
(RefSeq) neutral alpha-glucosidase AB isoform X1
  KO
K05546  mannosyl-oligosaccharide alpha-1,3-glucosidase [EC:3.2.1.207]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107543105 (GANAB)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107543105 (GANAB)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.207  mannosyl-oligosaccharide alpha-1,3-glucosidase
     107543105 (GANAB)
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Other DBs
NCBI-GeneID: 107543105
NCBI-ProteinID: XP_016076014
LinkDB
Position
Unknown
AA seq 966 aa
MAAVAAVATRRRRSWTGLVLACLGVCLGITRAVDRSNFKTCAESSFCKRQRNIQPGLSPY
RALLDSLQFGPDGLTVHLINEVTKVLLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLV
ADPPTARLSVSGRDDNSVELTVAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLGFEH
QRAPRVSFSDKVSVTLGSIWDKIKNIFSRQGSKDPAEGDGAQPEETPGDGDKLEETQGKT
EKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADSLRLKVTEGGEPYR
LYNLDVFQYELYNPMALYGSVPVLLAHSPHRDLGIFWLNAAETWVDISSNTAGKTLFGKM
LDYLQGSGETPQTDVRWMSESGIIDVFLLLGPSVSAIFQQYASLTGTQALPPLFSLGYHQ
SRWNYRDEADVLEVNQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPLTMLEHLAS
KRRKLVAIVDPHIKVDSGYRVHEELQSQGLYVKTRDGSDYEGWCWPGAAGYPDFTNPRMR
AWWANMFNFDDYKGSAPNLYVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGFY
VHMATADGLVLRSGGVERPFVLSRAFFAGSQRFGAVWTGDNTADWDHLKISIPMCLSLGL
VGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQYHDMIR
DALGQRYSLLPFWYTLFYQAHREGIPVMRPLWVHYPQDVTTFSIDDQFLLGDALLVHPVS
DAGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIIPRWMRVRR
SSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRNEFLLRRFSFSGNALVSSSAD
PKGHFETPVWIERVVIMGAGKPASVVLQKKGSPESRLSFQHDPETSVLILRKPGVNVASD
WSIHLR
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggcggcggtagcggcagtggctacgcgtaggaggcggtcttggacaggtttggtactg
gcttgtttaggggtctgcctgggaatcacccgtgccgtggatagaagcaactttaagacc
tgtgcagagagttccttttgcaagcgtcagcgaaacatacagccaggcctctctccatac
cgagccttgttggattctctgcagtttggtcctgatggcctcacagtccatctgatcaac
gaggtcaccaaggtgctgctggtgttggagctccaagggcttcaaaagaacatgactcgg
atcagaattgatgaactggagccccggcgaccccgatatcgtgtgccagatgtgttggtg
gctgatccccccacagctcggctttctgtctctggccgtgacgacaacagtgtggagcta
actgtggctgagggaccttataaaatcatcctgacagcacggccattccgccttgacctg
ctagaggaccgcagccttctgctcagtgtcaatgcccgaggactcttaggttttgagcac
cagagggcccccagggtctctttctcggataaagttagtgtcacgctcggtagcatttgg
gataagatcaagaacattttctctaggcaaggatcaaaagacccagctgagggcgatggg
gcccagcccgaggaaacacctggggatggtgacaagctagaagagacccaggggaagaca
gagaaagatgagcctggagcctgggaggagacattcaaaactcactctgacagcaagccg
tatggccccatgtctgtgggcttggacttctctctgccaggcatggagcatgtgtatggg
atccctgagcatgcagacagcctgaggctgaaggtcactgagggtggggagccgtatcgc
ctctacaatttggatgtgttccagtacgagctctacaaccccatggccctgtatgggtct
gtgcctgtacttctggcacacagtcctcaccgggacctgggcatcttctggctcaacgcc
gcagagacttgggtagacatatcttccaacactgctgggaagaccctgtttgggaagatg
ctggactacctgcagggctctggggaaaccccgcagacagatgtgcgctggatgtcagaa
agcggcatcattgatgtcttcctgctgcttgggccctctgtctcagctatcttccagcag
tacgccagtctcacagggacccaggcattgcccccgctcttctccctcggctaccatcag
agccgctggaactaccgggacgaggccgatgtgctggaagtcaatcagggctttgatgat
cacaacctgccttgcgatgtcatctggctagacattgagcatgctgatggcaagcggtac
ttcacctgggaccccagccgtttcccccagcccctcaccatgcttgagcacttggcctcc
aagaggaggaagcttgtcgccattgtggatccccacatcaaggtagactctggctaccgt
gtacatgaagagttgcagagccagggcctatatgttaaaactcgggatggctctgactac
gagggctggtgctggccaggtgcagctggttaccccgacttcaccaatcccaggatgagg
gcctggtgggctaacatgttcaactttgacgattataagggctcagctcccaacctctat
gtctggaatgacatgaatgaaccatctgtgttcaatggtcctgaggtcaccatgctcaag
gatgcccagcattatgggggctgggagcaccgagatgtgcataacatctatggcttctat
gtgcacatggcaactgctgatggactggtgctgcgctcggggggtgtcgaacgccccttt
gtcctgagcagggctttctttgctggctcccagcgctttggagccgtgtggacaggggac
aacactgctgattgggaccacttgaagatctctatccctatgtgtctcagcttggggctg
gtgggactttccttctgtggggctgatgtgggtggcttttttaagaatccagagccagag
ctgcttgtgcgctggtaccagatgggtgcctaccagccattcttccgggcacatgcccac
ttggacactgggcggcgagagccatggctgttaccatcccagtaccacgacatgatccga
gatgccctgggccagcggtattccttgttgcctttctggtacaccctcttctatcaggcc
catcgtgaagggattcctgtcatgaggcccctatgggtacattatcctcaggatgtaaca
accttcagtatagatgatcagttcctgcttggagatgcattgctggttcaccctgtatca
gatgctggggctcatggtgtacaggtctatttgcctggccaaggggaggtgtggtatgac
attcagagctaccagaaacatcatggtccccagaccctgtacctgcctgtaactctaagt
agtatccctgtgttccagcgtggagggacaattatacctcgatggatgagagtgcggcgt
tcttcagactgtatgaaggatgaccccatcactctttttgttgcactcagcccccagggt
acagcccaaggagagctctttctagatgatgggcacacattcaactatcagactcgcaat
gagttcctgctgcgtcgattctcattctctggcaacgccctcgtctctagctcagcagac
cccaaaggccactttgagacaccagtttggattgagcgagtggtgatcatgggggctgga
aagccagcatccgtggtactccagaagaaaggatctcctgaaagccgcctgtccttccag
catgaccctgagacctctgtgctgatcctgcgcaagcctggcgtcaacgtagcatctgac
tggagtattcacctgcgataa

DBGET integrated database retrieval system