KEGG   Miniopterus natalensis: 107533446
Entry
107533446         CDS       T05883                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7 isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04064  NF-kappa B signaling pathway
mna04140  Autophagy - animal
mna04152  AMPK signaling pathway
mna04310  Wnt signaling pathway
mna04380  Osteoclast differentiation
mna04520  Adherens junction
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04660  T cell receptor signaling pathway
mna04668  TNF signaling pathway
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05161  Hepatitis B
mna05162  Measles
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107533446 (MAP3K7)
   04310 Wnt signaling pathway
    107533446 (MAP3K7)
   04064 NF-kappa B signaling pathway
    107533446 (MAP3K7)
   04668 TNF signaling pathway
    107533446 (MAP3K7)
   04152 AMPK signaling pathway
    107533446 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107533446 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107533446 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107533446 (MAP3K7)
   04620 Toll-like receptor signaling pathway
    107533446 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    107533446 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    107533446 (MAP3K7)
   04660 T cell receptor signaling pathway
    107533446 (MAP3K7)
   04657 IL-17 signaling pathway
    107533446 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107533446 (MAP3K7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107533446 (MAP3K7)
   05161 Hepatitis B
    107533446 (MAP3K7)
   05171 Coronavirus disease - COVID-19
    107533446 (MAP3K7)
   05162 Measles
    107533446 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    107533446 (MAP3K7)
   05169 Epstein-Barr virus infection
    107533446 (MAP3K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107533446 (MAP3K7)
   05135 Yersinia infection
    107533446 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107533446 (MAP3K7)
   05140 Leishmaniasis
    107533446 (MAP3K7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107533446 (MAP3K7)
   05418 Fluid shear stress and atherosclerosis
    107533446 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107533446 (MAP3K7)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107533446 (MAP3K7)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: TKL group
  MLK family
   107533446 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 107533446
NCBI-ProteinID: XP_016063619
LinkDB
Position
Unknown
AA seq 607 aa
MSTASAASSSSSSSASDMIEAPTQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSLRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPSTNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARISATTACSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLSVTGTEPGQVSSRSSSPSIRMITTTSGPTSEKPARSH
PWTPDDSIDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTE
IALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQ
QKRQGTS
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtctacagcctccgccgcttcctcctcctcctcgtcttcggccagtgatatgatcgaa
gcccccacccaagtcctcaactttgaagaaatcgactataaggagatcgaagtggaagag
gttgttggaagaggagcctttggagtagtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcttttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagttatatggagcctgtttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccgtattacactgctgcccatgccatgagttggtgtttacaatgttcccaagga
gtggcttatcttcacagcatgcagcccaaagccctaattcacagggacctgaaaccacca
aacttgctgctggtcgcaggggggacagttttaaaaatctgtgattttggtacagcctgt
gatattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagcaattacagtgaaaaatgtgatgtcttcagctggggtattatcctttgg
gaagtgataacgcgtcggaaaccctttgatgagatcggtggcccagctttccgtattatg
tgggctgttcataacggtactcgaccaccactgatcaaaaatttacctaagcccattgaa
agcctgatgactcgctgctggtcaaaagatccttctctgcgcccttcaatggaggagatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccgttacaatac
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacatcgcttctacaaataccagtaataaaagcgacactaatatggagcaagttccttcc
acaaacgatactattaagcgcttagaatcaaaattactgaaaaatcaggcaaagcaacag
agtgaatctggccgtttaagcttgggagcgtcccgtgggagcagtgtagagagcttgccc
ccaacttccgagggcaagaggatgagtgctgacatgtctgaaatagaagccaggatttct
gcgaccacagcctgttccaagcctaaacggggccatcgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtagatccatc
caagacttgagtgttactggaacagaacctggtcaggtgagcagtaggtcatccagtcct
agcatcagaatgatcactactacctcaggaccaacctcagaaaagccagctagaagtcat
ccatggacccctgatgattccatagataccaatggatcagataactccatcccaatggct
tatcttacactggatcatcaactacagcctctggcaccatgcccaaactccaaagaatct
atggcagtgtttgaacaacattgtaaaatggcacaagaatatatgaaagtgcagacggaa
attgcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaag
gaccagcaaaatacatctcgtctggtacaggaacataaaaagcttttagatgaaaacaaa
agcctttctacttactaccagcaatgcaaaaaacaactagaggtcatcagaagtcagcag
caaaaacgacaaggcacttcatga

DBGET integrated database retrieval system