KEGG   Miniopterus natalensis: 107533821
Entry
107533821         CDS       T05883                                 

Gene name
FOS
Definition
(RefSeq) LOW QUALITY PROTEIN: proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04024  cAMP signaling pathway
mna04210  Apoptosis
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04713  Circadian entrainment
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04932  Non-alcoholic fatty liver disease
mna04935  Growth hormone synthesis, secretion and action
mna05031  Amphetamine addiction
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05161  Hepatitis B
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05224  Breast cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05323  Rheumatoid arthritis
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107533821 (FOS)
   04668 TNF signaling pathway
    107533821 (FOS)
   04024 cAMP signaling pathway
    107533821 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107533821 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107533821 (FOS)
   04660 T cell receptor signaling pathway
    107533821 (FOS)
   04658 Th1 and Th2 cell differentiation
    107533821 (FOS)
   04659 Th17 cell differentiation
    107533821 (FOS)
   04657 IL-17 signaling pathway
    107533821 (FOS)
   04662 B cell receptor signaling pathway
    107533821 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107533821 (FOS)
   04917 Prolactin signaling pathway
    107533821 (FOS)
   04921 Oxytocin signaling pathway
    107533821 (FOS)
   04926 Relaxin signaling pathway
    107533821 (FOS)
   04935 Growth hormone synthesis, secretion and action
    107533821 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    107533821 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    107533821 (FOS)
   04728 Dopaminergic synapse
    107533821 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107533821 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107533821 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533821 (FOS)
   05207 Chemical carcinogenesis - receptor activation
    107533821 (FOS)
   05231 Choline metabolism in cancer
    107533821 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107533821 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107533821 (FOS)
   05224 Breast cancer
    107533821 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107533821 (FOS)
   05170 Human immunodeficiency virus 1 infection
    107533821 (FOS)
   05161 Hepatitis B
    107533821 (FOS)
   05171 Coronavirus disease - COVID-19
    107533821 (FOS)
   05162 Measles
    107533821 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107533821 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107533821 (FOS)
   05135 Yersinia infection
    107533821 (FOS)
   05133 Pertussis
    107533821 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107533821 (FOS)
   05142 Chagas disease
    107533821 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107533821 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    107533821 (FOS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107533821 (FOS)
   05418 Fluid shear stress and atherosclerosis
    107533821 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107533821 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107533821 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107533821 (FOS)
   04131 Membrane trafficking [BR:mna04131]
    107533821 (FOS)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    107533821 (FOS)
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107533821 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Macoilin HALZ
Other DBs
NCBI-GeneID: 107533821
NCBI-ProteinID: XP_016064150
LinkDB
Position
Unknown
AA seq 389 aa
MMFSSFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLASSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTETAGWIETAPQTRCQGAGKL
QGAWSRRQTRLLTFGLFSFXLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQ
LEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEELSVASLDLSGGLPEAA
NPESEEAFALPLLSDPEPKPSVEPIKNLSSVELKAEPFDDFLFPASSRPSGSETSRSVPD
MDLSGSFYAADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSY
PSCAAAHRKGSSSNEPSSDSLSSPTLLAL
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgatgttctcaagcttcaacgccgactacgaggcttcctcctcgcgctgcagcagcgct
tccccggctggcgacagcctgtcttactaccactccccggccgactccttctccagcatg
ggctctccggtcaacgcgcaggacttctgcacggacctggcatcctccagtgccaacttc
atcccgactgtgactgccatctcgaccagcccggacctgcagtggctggtgcagcccacc
ctcgtctcctccgtggccccatcccagaccagagccccccacccctacggagtccccact
gaaactgcgggttggatagaaacggctccacagacaaggtgccagggagctgggaagctg
cagggtgcatggagccgacggcagacgcggttactgaccttcggtcttttttccttctag
ttgtccccagaagaagaagagaagaggagaatccgaagggaaaggaataagatggctgca
gccaaatgccgaaaccggaggagggagctgaccgacacgctgcaagcggagacggaccag
ctagaagacgagaagtctgccttgcagaccgagatcgccaacctgctgaaggagaaggaa
aagctggagttcatcctggcggcgcaccggcctgcctgcaagatccccgacgacctgggc
ttcccggaggagctgtccgtggcttccctcgacctgagtggaggcctgcctgaggccgcc
aaccctgagtccgaggaggccttcgccctgcccctcctcagcgaccctgagcccaagccc
tccgtggagcccatcaaaaacctgagcagcgtggagctgaaggctgagcccttcgatgac
ttcctgttccccgcatcgtccaggcccagcggctctgagacctcccgctcggtgcccgac
atggacctgtctggttccttctatgcagcagactgggagcccctgcacggtggctccctg
gggatggggcccatggccacagagctggagcccctgtgcaccccggtggtcacctgcact
cccagctgcactacctacacgtcttccttcgtcttcacctaccccgaggccgactcctac
cccagctgtgcggccgcccaccgcaagggcagcagcagcaacgagccctcctctgactcg
ctcagctcacccacgttgctggccctgtga

KEGG   Miniopterus natalensis: 107536966
Entry
107536966         CDS       T05883                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04024  cAMP signaling pathway
mna04137  Mitophagy - animal
mna04210  Apoptosis
mna04310  Wnt signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04530  Tight junction
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05161  Hepatitis B
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05224  Breast cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05321  Inflammatory bowel disease
mna05323  Rheumatoid arthritis
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536966 (JUN)
   04012 ErbB signaling pathway
    107536966 (JUN)
   04310 Wnt signaling pathway
    107536966 (JUN)
   04668 TNF signaling pathway
    107536966 (JUN)
   04024 cAMP signaling pathway
    107536966 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107536966 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    107536966 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107536966 (JUN)
   04530 Tight junction
    107536966 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107536966 (JUN)
   04621 NOD-like receptor signaling pathway
    107536966 (JUN)
   04625 C-type lectin receptor signaling pathway
    107536966 (JUN)
   04660 T cell receptor signaling pathway
    107536966 (JUN)
   04658 Th1 and Th2 cell differentiation
    107536966 (JUN)
   04659 Th17 cell differentiation
    107536966 (JUN)
   04657 IL-17 signaling pathway
    107536966 (JUN)
   04662 B cell receptor signaling pathway
    107536966 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536966 (JUN)
   04915 Estrogen signaling pathway
    107536966 (JUN)
   04921 Oxytocin signaling pathway
    107536966 (JUN)
   04926 Relaxin signaling pathway
    107536966 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107536966 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107536966 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536966 (JUN)
   05207 Chemical carcinogenesis - receptor activation
    107536966 (JUN)
   05203 Viral carcinogenesis
    107536966 (JUN)
   05231 Choline metabolism in cancer
    107536966 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107536966 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107536966 (JUN)
   05211 Renal cell carcinoma
    107536966 (JUN)
   05224 Breast cancer
    107536966 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107536966 (JUN)
   05170 Human immunodeficiency virus 1 infection
    107536966 (JUN)
   05161 Hepatitis B
    107536966 (JUN)
   05171 Coronavirus disease - COVID-19
    107536966 (JUN)
   05162 Measles
    107536966 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107536966 (JUN)
   05169 Epstein-Barr virus infection
    107536966 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536966 (JUN)
   05135 Yersinia infection
    107536966 (JUN)
   05133 Pertussis
    107536966 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107536966 (JUN)
   05142 Chagas disease
    107536966 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107536966 (JUN)
   05321 Inflammatory bowel disease
    107536966 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    107536966 (JUN)
   05031 Amphetamine addiction
    107536966 (JUN)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107536966 (JUN)
   05418 Fluid shear stress and atherosclerosis
    107536966 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107536966 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107536966 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107536966 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107536966 (JUN)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107536966 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha DUF3450 TFIIA TMF_DNA_bd
Other DBs
NCBI-GeneID: 107536966
NCBI-ProteinID: XP_016068382
LinkDB
Position
Unknown
AA seq 289 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLGDPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVGGAGLVAPAVASVAGGSGSGQQQQPPQPPHHLPQQIPVQHPRL
QALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEE
KVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 870 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctgggcgatccggtgggcagcctgaagcctcacctccgggccaagaactctgacctc
ctcacctcgcccgacgtggggctgctcaaactggcctcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacggacgagcaggagggcttcgcggagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcggcggggcg
ggcctggtggctccagcggtggcttcggtggcgggcggcagcggcagcggccagcagcag
cagccgccgcagccgccgcaccacctgccccagcagatccccgtgcagcacccgcggctg
caggctctgaaggaggagccgcagacggtccctgaaatgccgggggaaacaccgcccctg
tcccccatcgacatggagtcccaggagcggatcaaggcggagaggaagcgcatgaggaac
cgcattgctgcctccaagtgccggaaaaggaagctggagagaatcgcccggctggaggaa
aaagtgaaaaccttgaaagcgcagaactcggagctggcgtctacagccaacatgctcagg
gaacaggtggcacagcttaaacagaaagtcatgaaccacgttaatagcgggtgccaactc
atgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system