KEGG   Miniopterus natalensis: 107533843
Entry
107533843         CDS       T05883                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 isoform X1
  KO
K13377  transforming growth factor beta-3
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04060  Cytokine-cytokine receptor interaction
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04218  Cellular senescence
mna04350  TGF-beta signaling pathway
mna04390  Hippo signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05144  Malaria
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05220  Chronic myeloid leukemia
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05321  Inflammatory bowel disease
mna05323  Rheumatoid arthritis
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107533843 (TGFB3)
   04350 TGF-beta signaling pathway
    107533843 (TGFB3)
   04390 Hippo signaling pathway
    107533843 (TGFB3)
   04068 FoxO signaling pathway
    107533843 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107533843 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107533843 (TGFB3)
   04218 Cellular senescence
    107533843 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533843 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107533843 (TGFB3)
   05212 Pancreatic cancer
    107533843 (TGFB3)
   05225 Hepatocellular carcinoma
    107533843 (TGFB3)
   05226 Gastric cancer
    107533843 (TGFB3)
   05220 Chronic myeloid leukemia
    107533843 (TGFB3)
   05211 Renal cell carcinoma
    107533843 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107533843 (TGFB3)
   05161 Hepatitis B
    107533843 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107533843 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107533843 (TGFB3)
   05144 Malaria
    107533843 (TGFB3)
   05145 Toxoplasmosis
    107533843 (TGFB3)
   05140 Leishmaniasis
    107533843 (TGFB3)
   05142 Chagas disease
    107533843 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107533843 (TGFB3)
   05321 Inflammatory bowel disease
    107533843 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107533843 (TGFB3)
   05414 Dilated cardiomyopathy
    107533843 (TGFB3)
   05415 Diabetic cardiomyopathy
    107533843 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107533843 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107533843 (TGFB3)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107533843 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107533843
NCBI-ProteinID: XP_016064181
LinkDB
Position
Unknown
AA seq 408 aa
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFSHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQILALYNSTRELLEEREDGCTQENTEWEYYAKEIHKFDMIQGLAEHNELAVCP
KGVTSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQR
YIGGKNLPTRGTPEWLSFDVTDTVREWLSRRESNLGLEISIHCPCHTFQPNGDILENIHE
VMEIKFKGVDSEDDHGRGDLGRLRKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRALDT
NYCFSNVEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSKVLGL
YNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEHLSNMVVKSCKCS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctttctctgtccacttgcaccaccttggacttcagccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaaactcaggctcactagtccccctgagccatcg
gtgatgacccacgtcccctaccagatcctggccctttacaacagcaccagggagctgctg
gaggagagggaggacggctgcactcaggaaaacaccgagtgggagtactatgccaaagaa
atccataagttcgacatgatccaggggctggcggaacacaatgagctggcggtctgcccc
aaaggagtcacctccaaggttttccgcttcaacgtgtcctcagtggagaaaaatggaacc
aacctgttccgggcggaattccgagtcttgcgggtgcccaaccccagctccaagcgcaac
gagcagaggatcgagctcttccagatactccggccggatgagcacatcgccaaacagcgt
tatattggtggcaagaatctgcccacgcggggcactcccgagtggctgtcttttgatgtc
actgacactgtgcgtgaatggctctctcgaagagagtccaacttaggtctggaaatcagc
attcactgtccctgccacacctttcagcccaatggagacatcctggaaaacattcacgag
gtgatggaaatcaagttcaaaggtgtggacagtgaggacgatcatggccgtggggatctg
gggcgcctcaggaagcagaaggaccaccacaaccctcatctaatcctcatgatgatccct
ccgcatcggctcgacaacccgggccaggggggtcagaggaagaagcgggccctggacacc
aattactgctttagtaacgtggaagagaactgctgtgtgcgtcctctctacatcgacttc
cgccaggacctgggctggaaatgggtccacgaacctaagggctactacgccaacttctgc
tcaggcccttgcccatacctccgcagcgcagacaccacccacagcaaggtgctgggcctg
tataacaccttgaaccccgaagcgtctgcctcaccttgctgcgtgccccaggacttggag
cccttgaccatcctgtactacgtcgggaggacccccaaggtggaacatctctctaacatg
gtggtgaagtcctgtaagtgtagctga

KEGG   Miniopterus natalensis: 107534176
Entry
107534176         CDS       T05883                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04060  Cytokine-cytokine receptor interaction
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04218  Cellular senescence
mna04350  TGF-beta signaling pathway
mna04380  Osteoclast differentiation
mna04390  Hippo signaling pathway
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04926  Relaxin signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05144  Malaria
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05220  Chronic myeloid leukemia
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05321  Inflammatory bowel disease
mna05323  Rheumatoid arthritis
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107534176 (TGFB1)
   04350 TGF-beta signaling pathway
    107534176 (TGFB1)
   04390 Hippo signaling pathway
    107534176 (TGFB1)
   04068 FoxO signaling pathway
    107534176 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107534176 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107534176 (TGFB1)
   04218 Cellular senescence
    107534176 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107534176 (TGFB1)
   04672 Intestinal immune network for IgA production
    107534176 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107534176 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107534176 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534176 (TGFB1)
   05205 Proteoglycans in cancer
    107534176 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107534176 (TGFB1)
   05212 Pancreatic cancer
    107534176 (TGFB1)
   05225 Hepatocellular carcinoma
    107534176 (TGFB1)
   05226 Gastric cancer
    107534176 (TGFB1)
   05220 Chronic myeloid leukemia
    107534176 (TGFB1)
   05211 Renal cell carcinoma
    107534176 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107534176 (TGFB1)
   05161 Hepatitis B
    107534176 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107534176 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107534176 (TGFB1)
   05144 Malaria
    107534176 (TGFB1)
   05145 Toxoplasmosis
    107534176 (TGFB1)
   05140 Leishmaniasis
    107534176 (TGFB1)
   05142 Chagas disease
    107534176 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107534176 (TGFB1)
   05321 Inflammatory bowel disease
    107534176 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107534176 (TGFB1)
   05414 Dilated cardiomyopathy
    107534176 (TGFB1)
   05415 Diabetic cardiomyopathy
    107534176 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107534176 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107534176 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107534176 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107534176 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107534176 (TGFB1)
Chaperones and folding catalysts [BR:mna03110]
 Intramolecular chaperones
  Others
   107534176 (TGFB1)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107534176 (TGFB1)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107534176 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107534176
NCBI-ProteinID: XP_016064653
LinkDB
Position
Unknown
AA seq 363 aa
MPPSGLRLRLLPLLLPLLRLLVLTPGPPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLR
LASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPETDYYAKEVTRVLTVDNNH
EIYKTYKHNSHSIYMFFNTSDLREAVPEPELLSRAELRLQRHKLKVEQHVELYQKYSNNS
WRYLSNQLLAPSDSPEWLSFEVTGVVRQWLSHRGEIQGFRLNAHCSCDNKDNVLHVEING
ISVGRRGDLATIHSINRPFLLLMATPLERAQQLHSPRHRRALDTNYCFSSTEKNCCVRQL
YIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVRVAHRLKVAGTEGGAREKY
TLR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgcggctgctgccgctgctgctgccgctgctgaggcta
ctagtgctcacgcctggcccgccggccgccggactgtccacctgcaagaccatcgacatg
gagctggtgaagcggaagcgcattgaggccatccgcggccagattctgtccaagctgcgg
ctcgccagccccccgagccagggggaggtgccgcccgggccgctgcccgaggccgtgctg
gcgctttacaacagtacccgcgaccgggtggccggggagagcgccgagcccgagcccgag
cccgagacggactactacgccaaggaggtcacccgcgtgctaaccgtggataacaaccac
gaaatctataagacatacaagcataactcacacagcatatatatgttcttcaacacgtcg
gatctccgggaagctgtgccggaacccgagctgctctcccgggcagagctgcgcctgcag
aggcacaagttgaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcc
tggcgctacctcagcaaccagctgctggcccccagcgactcgcccgagtggctgtccttt
gaggtcactggagttgtgcggcagtggctgagccacagaggtgagatccagggctttcgc
ctcaatgcccactgctcctgtgacaacaaagataacgtactccatgtggaaatcaacgga
atcagtgtcggccgccgtggtgacctggccaccattcacagcataaaccggcccttcctg
cttctcatggccaccccgctggagagagcccagcagctgcacagcccccggcaccgccga
gccctggacaccaactactgcttcagctccacggagaaaaactgctgcgtgcggcagctc
tacatcgacttccgcaaggacctgggctggaaatggatccacgagcccaagggctaccac
gccaacttctgcctgggcccctgcccctacatttggagcctggacacgcagtacagcaag
gtgcgtgtggcccaccggctgaaggtagcagggaccgagggaggggccagagagaagtac
accctgagatga

KEGG   Miniopterus natalensis: 107543622
Entry
107543622         CDS       T05883                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04060  Cytokine-cytokine receptor interaction
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04218  Cellular senescence
mna04350  TGF-beta signaling pathway
mna04380  Osteoclast differentiation
mna04390  Hippo signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05144  Malaria
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05220  Chronic myeloid leukemia
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05321  Inflammatory bowel disease
mna05323  Rheumatoid arthritis
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107543622 (TGFB2)
   04350 TGF-beta signaling pathway
    107543622 (TGFB2)
   04390 Hippo signaling pathway
    107543622 (TGFB2)
   04068 FoxO signaling pathway
    107543622 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543622 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107543622 (TGFB2)
   04218 Cellular senescence
    107543622 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107543622 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543622 (TGFB2)
   05206 MicroRNAs in cancer
    107543622 (TGFB2)
   05205 Proteoglycans in cancer
    107543622 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107543622 (TGFB2)
   05212 Pancreatic cancer
    107543622 (TGFB2)
   05225 Hepatocellular carcinoma
    107543622 (TGFB2)
   05226 Gastric cancer
    107543622 (TGFB2)
   05220 Chronic myeloid leukemia
    107543622 (TGFB2)
   05211 Renal cell carcinoma
    107543622 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107543622 (TGFB2)
   05161 Hepatitis B
    107543622 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107543622 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107543622 (TGFB2)
   05144 Malaria
    107543622 (TGFB2)
   05145 Toxoplasmosis
    107543622 (TGFB2)
   05140 Leishmaniasis
    107543622 (TGFB2)
   05142 Chagas disease
    107543622 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107543622 (TGFB2)
   05321 Inflammatory bowel disease
    107543622 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107543622 (TGFB2)
   05414 Dilated cardiomyopathy
    107543622 (TGFB2)
   05415 Diabetic cardiomyopathy
    107543622 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107543622 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107543622 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107543622 (TGFB2)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107543622 (TGFB2)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107543622 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107543622
NCBI-ProteinID: XP_016076682
LinkDB
Position
Unknown
AA seq 442 aa
MHCCVLSAFLLLHLAAAALGLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EDVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVQEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactgctgcgtgctgagcgcgttcctgctcctgcatctggccgcggccgcgctcggc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgagccc
gaggacgtgcccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggcgcgcggccgcctgcgagcgcgagcgcagcgacgaggaatactacgcg
aaggaggtgtacaagatcgacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcaggattgtccggttc
gacgtctcggcgatggaaaaaaatgcttccaacctggtgaaggcagagttcagagtgttc
cgcctgcagaacccaaaggccagggttcccgaacagcggatcgagctgtaccagatcctc
aaatccaaagacctgacgtctccaacccagcgctacatcgacagcaaagtggtgaaaacc
agggcggagggggaatggctttccttcgacgtgacggacgctgtgcaggaatggctccac
cacaaagacaggaacctgggatttaagataagcttgcactgtccctgctgcaccttcgtg
ccctctaataattacatcatccccaacaaaagcgaggaactggaggcacggttcgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttaccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgcgctctggatgcagcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatcttgggtgg
aaatggatccatgaacccaaagggtacaatgccaacttctgtgctggggcatgcccgtat
ctctggagttcagacacgcagcacagtagggtcctcagcctgtataataccataaacccc
gaagcctccgcctcgccttgctgcgtgtcccaggacctggagccgctgaccatcctctac
tacatcggcaagacccccaagatcgagcagctctccaacatgatcgtcaagtcgtgcaaa
tgcagctaa

DBGET integrated database retrieval system