KEGG   Miniopterus natalensis (Natal long-fingered bat): 107534342
Entry
107534342         CDS       T05883                                 
Symbol
PREB
Name
(RefSeq) prolactin regulatory element-binding protein isoform X1
  KO
K14003  prolactin regulatory element-binding protein
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107534342 (PREB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107534342 (PREB)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    107534342 (PREB)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nbas_N
Other DBs
NCBI-GeneID: 107534342
NCBI-ProteinID: XP_016064911
LinkDB
Position
Unknown
AA seq 418 aa
MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLEQINGRLSAS
LLHSHDTETRATMNLALAGNILAAGQDAHCQLLRFQTHQQKGKNKAEKAGSKEQGPRQRK
GAAPTEKKSGAETHQEGVELIVENLQAVQTDFSPDPLQKVVCYNHDNTLLATGGTDGYVR
VWKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGWDLKAFVWQKDQLVTQLHWQENGPT
FSNTPYRYQACRFGQVPDQPSGLRLFTVQIPHKRLRQPPPCYLTAWDGSTFLPLRTKSCG
HEVISCLTVSESGTFLGLGTVTGSVAIYIAFSLQRLYYVREAHGIVVTDVAFLPEKGRGP
ELLGSHETALFSVAVDSRCQLHLLPSRRSVPMWLLLLLCVGLIVMTILLLQSAFPGFL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggtcggcgccgggcgcccgagctctaccgggccccgttcccgttgtacgcgcttcag
gtggaccccagcacggggctgctcatcgctgcgggcggaggaggcgccgccaagacgggc
ataaagaacggagtgcattttctgcagctagagcagattaacgggcgcctgagcgcctcc
ttgctacactcccatgatacagagacacgagctactatgaacttggcgctggcaggtaac
atccttgctgcaggacaggatgcccactgtcagctcctgcgcttccagacccaccagcag
aagggcaaaaacaaggcagagaaggcaggttccaaggagcaggggcctcgacaaagaaag
ggggcggccccaacagagaagaaatctggagctgaaactcaccaggagggggtagaactg
atagtagagaatttgcaggcagtgcagacagacttcagccctgatccactgcagaaagtt
gtatgctacaaccacgataataccctgcttgccactggagggacagatggctatgttcgt
gtctggaaggtacccagcctagagaaagtgctggagttcaaagcccacgaaggggagatt
gaggacctggctttggggcctgatggcaagctggtgactgtgggctgggaccttaaagcc
ttcgtgtggcagaaggatcagctggtgacacagctgcactggcaagagaatggacccacc
ttttctaacacgccttaccgctaccaagcctgcaggtttgggcaggttccagaccagcct
tctgggctacgactcttcacagtgcagattccccacaagcgtctgcgccagcccccaccc
tgctacctcacagcctgggatggctctaccttcttgcctcttcggaccaaatcctgtggc
catgaagtcatctcctgccttactgttagtgaatcgggcaccttcctaggcctgggcaca
gtcactggatctgttgccatctacatagctttctctctccagcgcctctactatgtgaga
gaagcccatggcattgtagtgacggatgtggcctttctacctgagaagggtcgtggtcca
gagctccttgggtcccatgaaactgccctgttctccgtggctgtggatagtcgttgccag
ctgcacctactaccctcacgacggagtgttcctatgtggctgctgctgctgctatgcgtc
gggcttattgttatgaccatcctgctgctccagagtgcctttccaggttttctttag

DBGET integrated database retrieval system