KEGG   Miniopterus natalensis: 107534791
Entry
107534791         CDS       T05883                                 

Gene name
TNNC1
Definition
(RefSeq) troponin C, slow skeletal and cardiac muscles isoform X1
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107534791 (TNNC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107534791 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    107534791 (TNNC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107534791 (TNNC1)
   05414 Dilated cardiomyopathy
    107534791 (TNNC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107534791 (TNNC1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     107534791 (TNNC1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg TerB DUF5580 EF-hand_10 DUF5390
Other DBs
NCBI-GeneID: 107534791
NCBI-ProteinID: XP_016065497
LinkDB
Position
Unknown
AA seq 161 aa
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFEEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKVM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgacatctacaaggctgcggtagagcagctgacagaagagcagaaaaatgagttc
aaagcagcctttgacatcttcgtgctgggcgctgaggatggctgcatcagtaccaaggaa
ctgggcaaggtgatgagaatgctgggccagaatcccacacctgaggagctgcaggagatg
attgatgaggtggatgaagatggaagtggcacagtggacttcgaggagttcctggtcatg
atggttcggtgcatgaaggacgacagtaaagggaagtctgaggaggagctgtctgacctc
tttcgcatgtttgacaaaaacgctgatggctacattgacctggacgagctgaaggtgatg
cttcaggctactggtgagaccatcacggaggacgacatcgaggagctcatgaaggatggc
gacaagaacaacgatggccgcatcgactatgacgaattcctggagttcatgaagggggtg
gagtag

DBGET integrated database retrieval system