KEGG   Miniopterus natalensis (Natal long-fingered bat): 107535122
Entry
107535122         CDS       T05883                                 
Symbol
ATF6
Name
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 alpha
  KO
K09054  cyclic AMP-dependent transcription factor ATF-6 alpha
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107535122 (ATF6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107535122 (ATF6)
   05012 Parkinson disease
    107535122 (ATF6)
   05014 Amyotrophic lateral sclerosis
    107535122 (ATF6)
   05022 Pathways of neurodegeneration - multiple diseases
    107535122 (ATF6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107535122 (ATF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107535122 (ATF6)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107535122 (ATF6)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rootletin ZapB NYD-SP28_assoc
Other DBs
NCBI-GeneID: 107535122
NCBI-ProteinID: XP_016065948
LinkDB
Position
Unknown
AA seq 701 aa
MEYIISYEKPEQRDGVRQTREGAAGSLGLDAPLRARSGPPRSEDLCPRPATVXRPEEDWD
SALFAELGCFTDTEDLHLEAADEAYENNFDNLDFDLDLMAWETGIWDTNSQFCTVKDIKS
EPQPLSPASSSCSVLSPQLADSCASTQHVPEELDLSSASQMSPLSFYGESTNSPCSAEPP
KEDKPVTGSRSKTENGLTPKKKLQMNSKPSIQPKPLLLPAAPKTQTNSSVPAKTIIIQAL
PTLVPLAKQQPVISIHPAPTKGQTVVLSQPAVVQLQAPGVLPSPQPVLAVAGGAAPLANH
VVSVVPASVASSPVNGKLSVAKPVLQSTVRAVGSDVAVLRRQQRMIKNRESACQSRRKKK
EYMLGLEARLEAALSENEKLRQENGSLRRQLDQVVSENQRLKVPSLKRRAICVMVLLVLV
VLNFGPISILEQDSRRMNPSVNPANQRRHLLGFSAKEEQDPPDSIIRKDSYSYDHSVSND
KALMVLSEEPVLYLPPPPCQPLINTTESLRLNHELRGWVHRHQVERTKSRRTTGTQQKTR
ILQGALEQGSSSQLMAVQYTETTSLSRNSGSELQVYYASPRSYQDFFDAIRRRGDTFYVV
SFRRDHLLLPATTHNKTTRPKMSIVLPAVNINENVINGQDYEVMMQIDCQVMDTRILHIK
SSSVPPYLRDQQRNQTSTFFGSPPTATEAARVVSAIPESLQ
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggagtacataatttcttatgaaaaacctgaacagcgggacggagtgcggcaaactcgg
gaaggagctgccggatccctcggtctggatgcccccctccgggctcgctcgggacccccg
cgcagtgaggacctttgtccgcgcccggccaccgtcncgcggccggaggaggactgggat
tctgctctgtttgctgaacttggctgtttcacagacaccgaggacctgcacttggaagca
gcagatgaagcttatgaaaacaattttgataaccttgattttgatttggatttgatggca
tgggagacaggcatttgggacaccaacagccagttctgtacagttaaagatattaagtca
gaacctcagccactttctccagcctcctccagctgttcggtgttgtctccccagttagcg
gactcctgtgcttccactcagcacgttcctgaggagctggatttatcttccgcctcccaa
atgtctcccctttccttctatggagaaagcaccaacagtccctgctcagccgagccaccg
aaggaagacaagcccgtcacaggttccaggagcaaaaccgaaaatggactgactccaaag
aaaaaacttcagatgaattcaaaaccttcaattcagcccaagcctttgttgcttccagca
gcacccaagactcaaacaaactccagcgttcctgcgaaaaccatcattattcaggcactt
cccacactggtgccgttggccaagcagcagccggttatcagtatacaccctgcacccact
aaaggtcagactgtggtgctgtctcagcctgctgtggtacagctgcaggcgcccggagtc
ctgccctctccccagcctgtcctggcagtcgccgggggagctgcaccgcttgctaatcac
gtggtcagtgtggtaccagcctctgtggccagtagcccagtgaatggaaaactttctgtg
gctaaacctgtcctacagagtactgtgagagctgtgggttctgatgtggccgtgctgagg
aggcagcagcggatgatcaagaaccgggagtcggcctgccagtcccgcaggaagaagaag
gagtacatgctggggctggaggcgcggctggaggccgccctgtccgagaacgagaagctg
aggcaggagaacgggtcgctgaggcggcagctggaccaggtcgtgtcagagaaccagagg
cttaaggttcccagtctgaagcgaagagccatctgtgtgatggtgctgttggtgctggtt
gtcttgaactttggacccatcagcatattggaacaggattccaggagaatgaatcctagt
gtgaaccctgcaaatcaaaggaggcatcttcttggattttctgctaaggaggagcaagac
ccacctgacagcatcatcaggaaagacagctacagctatgaccattctgtctccaacgac
aaagccctgatggtgttgagtgaggagccagtgctctacctcccgcccccgccgtgccag
ccgctcatcaacaccacggagtccctcaggttaaatcacgaactccgagggtgggttcac
agacaccaagtggaaaggaccaagtcaagaagaacgaccggcactcagcagaaaacgcgc
atccttcagggtgctctggagcagggctccagctctcagctcatggctgtccagtacaca
gagaccaccagcctcagcaggaactcggggagtgagctccaggtgtactacgcttccccc
agaagttatcaagacttctttgatgccatccgcagaaggggagacacgttttacgtcgtg
tcatttagaagggatcacctgctgttaccagcgaccacccataacaagaccacgagacca
aagatgtccattgtgttgccagcagtaaacatcaatgagaatgttatcaatgggcaggac
tatgaagtgatgatgcagatcgactgccaggtgatggacacccgcatcctccacatcaaa
agctcgtctgttccaccctacctccgagaccagcagaggaaccagaccagtaccttcttt
gggtccccacccacagccacggaggcggcccgtgtggtcagcgccatcccggagtcactg
cagtag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107539006
Entry
107539006         CDS       T05883                                 
Symbol
ATF6B
Name
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04022  cGMP-PKG signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04151  PI3K-Akt signaling pathway
mna04211  Longevity regulating pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04668  TNF signaling pathway
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04915  Estrogen signaling pathway
mna04918  Thyroid hormone synthesis
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
mna05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107539006 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107539006 (ATF6B)
   04022 cGMP-PKG signaling pathway
    107539006 (ATF6B)
   04151 PI3K-Akt signaling pathway
    107539006 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107539006 (ATF6B)
   04915 Estrogen signaling pathway
    107539006 (ATF6B)
   04926 Relaxin signaling pathway
    107539006 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    107539006 (ATF6B)
   04918 Thyroid hormone synthesis
    107539006 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    107539006 (ATF6B)
   04925 Aldosterone synthesis and secretion
    107539006 (ATF6B)
   04927 Cortisol synthesis and secretion
    107539006 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107539006 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107539006 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    107539006 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    107539006 (ATF6B)
   05203 Viral carcinogenesis
    107539006 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107539006 (ATF6B)
   05161 Hepatitis B
    107539006 (ATF6B)
   05163 Human cytomegalovirus infection
    107539006 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    107539006 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    107539006 (ATF6B)
   05031 Amphetamine addiction
    107539006 (ATF6B)
   05034 Alcoholism
    107539006 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107539006 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107539006 (ATF6B)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107539006 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 107539006
NCBI-ProteinID: XP_016070858
LinkDB
Position
Unknown
AA seq 773 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDCALYTGLDEVAEEPTQLFRCPEQDVPFGSSML
DVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSLLSTEPSSQAPGVGEVLV
VKIESLAPPLCLLGDDPTCPTETVQINMGPTSDDPSGVQTKTEPVSPSSSINSEASLVSA
DSPNQTFIGKEVLEVKTESPAPQGCLLRDVPGPPLGAVQISMGSSPDGSSGKALPARKPP
LQPKPVVITTVPVPPRAMPPSTAVLLQPLVQPPPGIEEGKKELGWIDFLRELTATEALGC
LGVDTEPHFTYSSLTSFSCSLVPVSPVVLIQGAIRVQPEGPAPPAPRPERKSIVPAPMPG
NSRPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQLRRENAAL
RRRLEVLWAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISESPSAPVSPRMSGEEPL
PRRHLLEFSAQLPVHGAEPLQDSSQGPEEPQASFKGRPSFRNLTALPGGARELLLRDLDQ
LFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPRRAQERQGTRERSGGFEDQVLVE
ILRHFSFQKFQGWKKLPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRRED
TFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVM
DTRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPGSAAGQAPQAPHRPLYLNHP
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggcggagctcatgctcctcagcgagattgcggacccgacgcgatttttcacggacaac
ttgctgagcccggaggactgggactgcgccctgtacaccggcctggatgaggtggctgag
gagccgacgcagctcttccgctgcccggagcaggacgtcccgtttggcagcagcatgctg
gatgtggggatggatgtcagcccccccgaacctccatgggacccccttcctatcttcccg
gatcttcaagtgaagtctgaaccatcttctccctgctcttcctcctctctcagctccgaa
tcctcgcttctttccacagagccctccagccaggcccctggtgtaggggaggtactagtt
gtgaagatagagtccttggcacccccactctgcctcctgggagatgatccaacatgcccg
actgaaactgtccagatcaatatgggccccacctctgatgatccctcaggtgtccagacc
aagacagaacctgtctctccatcttcctccatcaactctgaggcttccttggtctccgca
gattcccccaaccagacttttataggaaaggaggtactggaagtgaagacagagtctcca
gctcctcaagggtgtctcctacgggatgtcccaggccccccgcttggagctgtccagatc
agcatgggttcatcccccgatggctcctcaggcaaagccctgcctgcccggaagccacca
ctgcagcctaaacctgtggtgataaccactgtcccagtgccacctagagccatgcctccc
agcaccgctgtccttttgcagccccttgtccagccacctccaggtattgaggaaggaaag
aaggagttgggctggattgactttctaagggagctcacagccactgaggcccttgggtgc
ttaggtgtggacacagaaccccacttcacttacagctctctgacctctttctcctgctca
cttgtcccagtgtccccagttgtccttattcaaggtgctatacgagtccagcctgagggg
ccagccccccctgctccacggcctgagaggaagagcattgttccagctcctatgcctggg
aactcccgcccacctgaagtggacgccaagctgctgaagcggcagcagcgaatgatcaag
aaccgggagtcagcttgccagtcccggaggaagaagaaggagtacctgcaggggctggag
gcgaggctgcaggctgtcctcgctgacaaccagcagctgcgccgggagaatgctgccctc
cggcggcggctggaagtcctgtgggccgagaacagcgagctcaagttagggtctggaaac
aggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgggcctgtc
agcatcagtgagtctccttcagctcccgtctctcctcggatgagtggagaggagcctcta
ccccggagacacttgctggagttctcagcacagttacccgttcatggagctgagcccctc
caggactcctcccagggccccgaggagccccaggccagcttcaagggccggccaagtttc
aggaacctgacagctctccctgggggtgccagggagctgctgctgagagacctggaccag
ctcttcctctcctcggactgccggcacttcaaccgaaccgagtccctgaggcttgctgat
gagctgagcggctgggtgcagcgccaccagagaggccggcggaagatgccccggagggcc
caggagagacagggaacaagggaacgttctgggggttttgaggatcaagtccttgtagag
atccttagacacttctccttccagaagtttcagggatggaagaagttgcctccagttaag
gcagtccccactcaacccccggggcccccagaaagggattctgtgggccagctgcagctg
tatcgccacccggaccgttcacagccagagttcctagatgcaattgaccgacgggaagac
acattttatgttgtctccttccggcgggaccacctgctgctcccagccatcagccacaac
aagacctctcggcccaagatgtccctggtgatgcccgccatggcccccaatgagaccctg
tcaggccggggtccccctggggactatgaggagatgatgcagatcgagtgtgaggtcatg
gataccagggtgattcacatcaagacctccacggtgcccccctcgctccgaaaacagccg
tcctccaccccgggcaatgccacgggtggccctctgccaggttctgcagctggccaggcc
ccccaggctccccaccggcccctctacctcaatcacccctga

DBGET integrated database retrieval system