KEGG   Miniopterus natalensis (Natal long-fingered bat): 107535203
Entry
107535203         CDS       T05883                                 
Symbol
LMAN1L
Name
(RefSeq) LOW QUALITY PROTEIN: protein ERGIC-53-like
  KO
K10081  lectin, mannose-binding 1-like
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107535203 (LMAN1L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107535203 (LMAN1L)
Lectins [BR:mna04091]
 L-type lectins
  107535203 (LMAN1L)
SSDB
Motif
Pfam: Lectin_leg-like T3SS_needle_E
Other DBs
NCBI-GeneID: 107535203
NCBI-ProteinID: XP_016066066
LinkDB
Position
Unknown
AA seq 494 aa
MGSSPDPLLCLLLLLLLLRAVGGHPPHXKFEYKLSFKGPRLALPGSGMPFWRHHGGASLG
LKEVQLVPSVWNXSGAVWSRAPVLFSGWVTRPGHQGVQVMVLWHTQEQGRSQLCLEKPAL
RDGIGILFDPSAQDTQALGPVWPSWTPSPHREGASQLLGSCYHDFRNWPYPFRAQLTKVS
LGSQQSPESCLTGVLPFPSLSHFPDDHNVLSFPTFGLSEPGPEAPLQPFLEMEQLHQARQ
LEGLQARLALGTREDMIPKLSSKDQEEGERIFDLEETLNRHKQILQGLSEHLAQAKRQWK
XQLAAGVPSQARPKGAWTHMASSAQVFYLPVGIKHHFLELAQILGLLQKDLWSPQCQKAA
DKDPCPPGLPPGPTSCLQPSVFLFFLLIQTIGFFXYMHFRQELDKSLXDCLXSLPLSPAP
CILMALGALRRQPLSPSMHACVTYLKALKECLFLFTGSGCVKLFKQLLGQQVGEKYEVGP
GAGFLPLPASLWEE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgggcagtagccctgatcccttgctctgccttctcctcctcctcctgctcctgagggct
gtggggggccatcctcctcattgaaagtttgagtacaagctcagcttcaaaggaccaagg
ctagcattacctgggtctgggatgccattctggaggcatcatggaggagccagcttgggc
ctgaaggaagtgcaactggtcccatccgtgtggaactgaagcggtgcagtgtggagcagg
gcccctgtcctcttctctggctgggtgaccaggccagggcaccagggagtccaggtcatg
gttctgtggcacacccaagagcaggggcgaagtcagctctgtttggagaagcctgccttg
agggatggcattgggatcctcttcgacccctcagcccaggatacccaggccttgggtcct
gtgtggccctcctggactccaagtccccacagagagggagccagccagctgctgggctct
tgctaccacgacttccggaactggccataccccttcagagcacagctcaccaaagtttcc
ctggggtctcagcagtcaccagaatcctgcctgacaggagttcttcccttcccttctcta
tcccactttcccgatgaccataatgtcttgtcctttccgaccttcggtctgagtgagcca
ggtccagaggctccactgcagcctttcctggagatggagcagctccaccaggcaaggcag
ctagaagggctacaggcaaggctggccctgggcaccagggaagacatgattccaaagctg
agctccaaagaccaggaagagggggaaagaatctttgacttggaggaaacattgaacaga
cacaagcagatcctgcaaggtctctctgagcacttggcccaggctaagagacaatggaag
tagcagctagcagctggggtgcctagtcaggccaggcctaagggagcctggactcacatg
gcttcaagcgcccaggtcttctacctgcctgtgggcatcaagcatcatttcttagagctg
gcccagatcctgggcctcctgcagaaggacctttggagcccgcaatgtcagaaagcagca
gacaaggacccctgcccacctggcctgcccccagggcccacctcatgcctgcagcccagc
gtcttcctgttcttcctcctcattcaaactataggtttctttntctacatgcacttcagg
caggagctggacaagagcctttaggactgtctgnntagccttcccctgagtcctgcacca
tgcatccttatggctctgggagctctgaggaggcagcccctctcccccagcatgcatgca
tgcgtgacctacctcaaagccctgaaggagtgtctatttctcttcactgggagtggatgt
gtgaagctcttcaagcagctgctggggcagcaagttggggagaagtatgaggtagggccc
ggggctggatttttgcccctccctgcttccctctgggaagagtag

DBGET integrated database retrieval system