KEGG   Miniopterus natalensis (Natal long-fingered bat): 107535732
Entry
107535732         CDS       T05883                                 
Symbol
PARK2
Name
(RefSeq) E3 ubiquitin-protein ligase parkin
  KO
K04556  parkin [EC:2.3.2.31]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04137  Mitophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107535732 (PARK2)
   04120 Ubiquitin mediated proteolysis
    107535732 (PARK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107535732 (PARK2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107535732 (PARK2)
   05014 Amyotrophic lateral sclerosis
    107535732 (PARK2)
   05022 Pathways of neurodegeneration - multiple diseases
    107535732 (PARK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107535732 (PARK2)
   04121 Ubiquitin system [BR:mna04121]
    107535732 (PARK2)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107535732 (PARK2)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     107535732 (PARK2)
Membrane trafficking [BR:mna04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    107535732 (PARK2)
  Aggrephagy
   Other aggrephagy associated proteins
    107535732 (PARK2)
  Xenophagy
   Other xenophagy associated proteins
    107535732 (PARK2)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    107535732 (PARK2)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    107535732 (PARK2)
SSDB
Motif
Pfam: zf-RING_14 zf-RING_12 ubiquitin IBR Rad60-SLD Dsc3_N Rad60-SLD_2
Other DBs
NCBI-GeneID: 107535732
NCBI-ProteinID: XP_016066758
LinkDB
Position
Unknown
AA seq 597 aa
MVKETLLWCLCNEGFGCCRGQRAPGLYVGVYVGVYVGVCVGVYVGLYPSCGTHGRILSIS
SQGIDFKMPSTPQGTTLIVTENLGAPLGPGLNSKKFKGENDREGGGEDGGEDGGEDGGED
GGEDGGEDGGEDGGEDGGEDDLFVRFNSSHGFPVEVDSATSILQLKKAVAKRQGVPADQL
RVIFAGKELRDDLVVQSCDLDQQSIVHVVLRPRREGQATTPGGDGPRSTAGASRREPESL
TRVDFSSSVLPTDSEGLAVILKADRPAGRPAGRPAYNSFYVYCKGPCQGVQPGKLRVRCS
SCQQTTLTLAQGPSCWEDVLTPNRMSGECQSPGCPGTSAEFFFKCSAHPTSDEETSVALN
LITTNRRGIPCITCTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSL
PCVAGCPDSLIKELHHFRILGEEQYNRYQLYGAEECVLQMGGVLCPGPGCGAGLLPEPQQ
RKVTCEGGDGLGCGLVFCRDCKDAFHEGECSALAAPGAAAQVYRVDAKAAEQARWEESSK
ETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCSCEWSRACMGDHWFDV
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggtcaaagaaacactgctgtggtgtctgtgtaacgaaggctttggctgctgccgtggg
caacgagccccgggtctctacgtgggtgtctacgtgggtgtctacgtgggtgtctgcgtg
ggtgtctacgtgggcctctacccctcgtgtggcacccacgggcgcatactctctatatcc
agccaaggcatcgactttaaaatgccgtcgactccacagggcacgactctgatagttacg
gaaaacctgggcgcccctctgggaccagggcttaatagcaagaagtttaagggagagaat
gacagggaaggtggcggggaagacggcggggaagacggcggggaagacggcggggaagac
ggcggggaagacggcggggaagatggcggggaagacggcggggaagatggcggggaagat
gacctgtttgtgaggttcaactccagccacgggttcccggtggaggtcgactcggccacc
agcatcctccagctcaagaaggcggttgccaagcgacagggggttccagccgaccagctg
cgtgtgatttttgcggggaaggagctcagggatgacttggtggtgcagagctgtgacctg
gaccagcagagcatcgtccacgtagtgctgagacccaggagagaaggccaggcgacgacc
cccggcggggacggtccccggagcactgcgggcgcctccaggagggagcctgagagcctc
acccgcgtggacttcagcagctctgtcctgccgaccgactcggagggcctggctgtcatt
ttgaaggctgaccggcccgcggggagaccagcaggcagaccagcctacaacagcttttac
gtctactgcaaaggcccctgccaaggagtgcagccaggaaaactcagagtgcgctgcagc
tcctgccagcaaaccacgctcaccttggcccagggcccgtcctgctgggaagatgtctta
accccaaaccggatgagtggggaatgccagtctccaggctgccctgggacaagcgcagaa
tttttctttaaatgttcagcacacccgacctctgacgaagaaacgtcagtagctttgaac
ctgatcacaacaaaccgtcgaggaatcccctgcatcacatgcacggacgtcaggagccct
gtcctggttttccagtgcaaccaccgccacgtgatctgcttggactgtttccacttgtac
tgcgtgaccaggctcaacgaccggcagttcgtccacgacccgcagctcggctactcgctg
ccctgtgtggctggctgccccgactccttgattaaagagctccatcacttcaggatcctt
ggagaagagcagtacaaccggtaccagctctacggcgccgaggagtgcgtgctgcagatg
ggcggcgtgctgtgccccggccctggctgcggggccgggctgctcccggagccccagcag
cggaaggtcacatgcgaagggggcgacggcctgggctgtgggctcgtcttctgccgggac
tgcaaggacgccttccacgaaggggagtgcagcgccctggccgccccgggagccgccgcc
caggtctacagggtggatgcgaaggccgcggagcaagctcgctgggaagaatcctccaaa
gaaaccatcaagaagaccaccaagccctgcccccgctgccacgtgcctgtggagaagaat
ggaggatgcatgcacatgaagtgcccgcagccccagtgccggctggagtggtgctggaac
tgcagctgcgagtggagccgcgcctgcatgggcgaccactggttcgacgtgtag

DBGET integrated database retrieval system