KEGG   Miniopterus natalensis: 107535877
Entry
107535877         CDS       T05883                                 

Gene name
PTPRM
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase mu isoform X1
  KO
K05693  receptor-type tyrosine-protein phosphatase mu [EC:3.1.3.48]
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107535877 (PTPRM)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107535877 (PTPRM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107535877 (PTPRM)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107535877 (PTPRM)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    107535877 (PTPRM)
SSDB
Motif
Pfam: Y_phosphatase MAM fn3 ig DSPc PTP_tm I-set Y_phosphatase3 Ig_3 PTPlike_phytase ECSCR EphA2_TM Ig_2 DctM DUF948
Other DBs
NCBI-GeneID: 107535877
NCBI-ProteinID: XP_016066943
LinkDB
Position
Unknown
AA seq 1485 aa
MRLGTCLATLAGLLLTAAGEAFSGGCLFDEPYSTCGYNQAEDDDFNWEQVNTLTKPTSDP
WMPSGSFMLVNTSGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSAPGLLNVYVKVN
NGPLGNPIWNLSGEPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGHP
CTRTPHFLRIQNVEVNAGQFATFQCSAIGRTLAGDRLWLQGIDVQDAPLKEIKVTSSRRF
IASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWIQ
LNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEG
GTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCY
QVGGQEQVREEVSWDTDNSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDEDL
PGAVPTESIQGSTFEEKIFLQWREPIQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVSK
LGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELEAPLNQTD
NTVTVMLKPAHSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASILNSQYYF
AAEFPANSLQAAQPFTIGDNKTYNGYWNTPLLPHKSYRIYFQAASRANGETKIDCVRVAT
KAAIIVTQLTTPYIRIAPAAGDDQLTGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVII
FLGVVLVMKKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTSCDEAFSFMDTHNLNG
RSVSSPSSFTMKTNTLSTSVPNSYYPDPFVPTAILDETHTMASDTSSLVQSHTYKKREAA
EVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQSAPWDSAKKDENRMKN
RYGNIIAYDHSRVRLQTIEGDTNSDYINGNYIDGYHRPNHYIATQGPMQETIYDFWRMVW
HENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGV
HEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPNSGPLVVHCSAGAGRTGCFIV
IDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSIPASQV
RSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDVLPPDR
CLPFLITIDGESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVMLN
DVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRIYNASRPQDGYRMVQQFQ
FLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFCAISIVCE
MLRHQRAVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNSG
NT seq 4458 nt   +upstreamnt  +downstreamnt
atgagacttgggacttgcctggcgactttggccggacttttgctaactgcagcaggggag
gcattttcaggaggttgcctcttcgatgaaccatatagcacgtgtggatataatcaagct
gaagatgatgacttcaactgggagcaggtgaacaccttgaccaaaccaacttctgatcca
tggatgccatcaggttctttcatgttggtgaacacatctgggagacctgagggtcagaga
gcccacctcctcttacctcagcttaaagaaaatgatacccactgcattgattttcactat
tttgtatccagcaagagtaattctgctcccggattactcaatgtctacgtgaaagtcaac
aacgggcctttggggaatcctatctggaatctatctggagagccgacgcgtacatggaac
agggcagaactggccattagtactttttggcctaacttttatcaggtgatttttgaagta
ataacttctggacatcaaggctacctcgctattgatgaagtgaaggtgttaggacatcca
tgtaccagaactccccacttcctgcggattcagaatgtggaagtgaatgccggccagttt
gccactttccagtgcagtgccattggcaggaccctggcaggggacaggctctggttacag
ggcattgatgtacaagatgctcctctgaaggaaataaaggtgactagttcccgacgattc
atagcttcctttaatgtggtgaacacaacaaaacgagatgctggaaagtaccgctgcatg
attcgcacagaaggaggtgttggaatatcaaactatgcagaattggttgttaaagaaccc
cctgttccgattgccccacctcagctggcctcagtgggggcgacctacctgtggatacaa
ctcaatgccaactccatcaatggggacgggcccattgttgcccgagaggtggaatactgc
acggcaagtgggagctggaatgaccggcagcctgtggattccacgagttacaagattggg
cacctcgacccagacaccgagtatgagatcagtgtgctcctcacccggccgggggaaggt
ggcactggatcccctgggccggcactcagaacaagaacaaagtgtgccgatcccatgaga
ggcccaaggaaactggaagtagtggaagtcaaatctcgacaaatcaccatccgctgggag
ccatttggatataatgtgactcgttgccatagttacaatctcacagtccactactgctac
caagttggaggacaggagcaggtgcgggaggaagtgagctgggacacggacaattcgcac
ccgcagcacaccatcactaacctctcgccctacaccaacgtcagtgtgaaactcatcctc
atgaatcccgagggcaggaaggaaagtcaggagctcatagtacagacggatgaagacctg
ccaggtgctgttcctactgaatccattcaaggaagtacgtttgaagagaagatatttctt
cagtggcgagaaccaattcaaacatatggtgtcatcactttatatgagatcacttacaaa
gcagtcagttcctttgacccagaaatagacttatccaatcaaagtggaagagtctcgaaa
cttggaaatgaaacccattttctgttttttggactgtatccagggacaacgtactccttt
accatccgagctagtacagctaagggttttggacctccagcaacaaatcagtttaccacc
aaaatatcagcaccctctatgccggcttatgaactcgaggcccctttgaatcaaactgac
aatacagtgacagtcatgctgaaacctgcgcacagccgaggcgcgcctgtcagtgtctac
caaatagttgttgaggaagaacgccctcgaagaactaaaaaaacaacagaaatcttaaag
tgctaccccgtgccaattcacttccagaatgcttccatcctgaactcacagtactacttt
gctgcagaattcccagcaaacagcctacaggctgctcagccttttactattggtgataac
aagacatacaatggatactggaacacccccctcctcccccataaaagctacagaatttat
ttccaagctgctagtagagccaatggggaaaccaaaatagactgtgttcgagtggccaca
aaagctgcgataatcgtgactcagcttacaacaccttacattcgcatcgcccctgccgca
ggcgacgaccagctgacaggagctgctactccaaaacctgtcccagaacctgagaaacaa
acagaccacacagttaaaattgctggagtcattgctggcatcctgctgtttgttattata
ttcctaggagttgtgctggtgatgaagaaaaggaaactcgccaagaagcggaaggagacc
atgagcagcacccggcaggagatgactgtgatggtgaactccatggacaagagctacgcc
gagcaaggcaccagctgcgacgaggccttctcattcatggacacgcacaatctcaacggg
aggtctgtgtcttcaccatcgtccttcacgatgaaaacaaacacactgagtacatcggtg
cctaattcctactacccagacccatttgtgccaactgcaattttagacgaaacccacacg
atggccagtgacaccagcagcttggtgcagtcgcacacgtacaagaagcgggaggcggcc
gaagtgccctaccagacggggcagctgcaccccgccatccgggtagcagacctgctccag
cacatcacgcagatgaagtgtgccgagggctacggcttcaaggaggaatacgagagcttc
tttgaagggcagtctgcgccatgggactctgctaagaaagatgagaacagaatgaagaac
agatatgggaatatcattgcatatgaccattccagggtgaggctgcagaccatagaagga
gacaccaactcagactatatcaatggaaattatatcgatggctatcatcgacccaatcat
tatattgctacccaaggaccaatgcaggagaccatctatgacttctggaggatggtgtgg
cacgaaaacaccgcgagcatcataatggtgaccaaccttgtggaagtggggagggtcaaa
tgctgcaaatactggccagatgacacagagatatataaagacattaaagttaccctaata
gaaacagaactactggcagaatatgtgataagaacatttgctgttgaaaagaggggcgtt
cacgaaatccgagagatcaggcagttccacttcactggctggccggatcacggggtccct
taccatgccaccgggctgctggggttcgtccggcaggtcaaatccaagagcccgcccaac
tcaggcccgttggtggtgcactgcagtgctggcgccgggaggaccggctgtttcatcgtc
atcgacatcatgctggacatggcggaaagggaaggggtggtggacatctacaactgcgtc
agggagctgcggtcccggagagtgaacatggtgcagacggaggagcaatatgtgtttatc
catgatgccatcctagaagcctgtctctgtggagacacctccatccccgcttcccaagtg
agatctctgtattatgacatgaacaaactggatccacagacaaattcaagccagattaaa
gaggaattccggaccctgaacatggtgacgccgacgctgcgcgtggaagactgtagcatc
gccctgctgccccggaaccacgagaaaaaccggtgcatggacgtcctgcccccggaccgc
tgcctgcctttcctcatcaccatcgacggggagagcagcaactacatcaacgccgccctc
atggacagctataaacagccttcggcttttatagtcacccagcaccctttgccaaataca
gtgaaagacttctggagactggtcctggattatcactgcacatctgtggttatgctaaat
gatgtggatccggcccagttgtgtccacagtactggccagagaacggagtacacagacat
ggtccgatccaagtggaatttgtttctgctgatttagaagaagacatcatcagcaggata
ttccgtatttataatgcatccagaccccaagacggatatcggatggtgcagcaattccag
ttcctgggctggccgatgtacagagacacgccagtgtccaagcgctccttcttgaagctc
atccgccaagtggacaagtggcaggaagaatacaacggcggagaaggccgcactgttgta
cactgcttgaacgggggcggccgcagcgggaccttctgcgccatcagcatcgtgtgcgag
atgctgcggcaccagcgggcggtggacgtgttccacgcggtgaagacgctgcgcaacaac
aagcccaacatggtcgacctgctggatcagtacaaattctgctacgaggtggccctggaa
tacttgaattctggctga

DBGET integrated database retrieval system