KEGG   Miniopterus natalensis (Natal long-fingered bat): 107536208
Entry
107536208         CDS       T05883                                 
Symbol
TRAF2
Name
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04010  MAPK signaling pathway
mna04064  NF-kappa B signaling pathway
mna04071  Sphingolipid signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04217  Necroptosis
mna04380  Osteoclast differentiation
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04668  TNF signaling pathway
mna04920  Adipocytokine signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05160  Hepatitis C
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05222  Small cell lung cancer
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107536208 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536208 (TRAF2)
   04064 NF-kappa B signaling pathway
    107536208 (TRAF2)
   04668 TNF signaling pathway
    107536208 (TRAF2)
   04071 Sphingolipid signaling pathway
    107536208 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107536208 (TRAF2)
   04217 Necroptosis
    107536208 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107536208 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    107536208 (TRAF2)
   04657 IL-17 signaling pathway
    107536208 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107536208 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107536208 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536208 (TRAF2)
   05203 Viral carcinogenesis
    107536208 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107536208 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107536208 (TRAF2)
   05160 Hepatitis C
    107536208 (TRAF2)
   05168 Herpes simplex virus 1 infection
    107536208 (TRAF2)
   05163 Human cytomegalovirus infection
    107536208 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107536208 (TRAF2)
   05169 Epstein-Barr virus infection
    107536208 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536208 (TRAF2)
   05135 Yersinia infection
    107536208 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536208 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    107536208 (TRAF2)
   05016 Huntington disease
    107536208 (TRAF2)
   05017 Spinocerebellar ataxia
    107536208 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    107536208 (TRAF2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107536208 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107536208 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107536208 (TRAF2)
   04121 Ubiquitin system [BR:mna04121]
    107536208 (TRAF2)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107536208 (TRAF2)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107536208 (TRAF2)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    107536208 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_4 SlyX MATH Dynamitin Med9 DUF848
Other DBs
NCBI-GeneID: 107536208
NCBI-ProteinID: XP_016067333
LinkDB
Position
Unknown
AA seq 504 aa
MAAASVTPPSSLDVLQPGFSKTLLGTKLEDKYLCSACKNVLRRPFQAQCGHRYCSFCLSS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAICPTDGCTWKGTLKE
YESCHEGHCPFMLTECPACRGLVRLCEKARHVEQECPGRSLSCPHCRAPCCWADVTAHHE
VCPKFPLTCDGCGKKKIPREKFQDHIRTCGKCPVPCRFHEVGCPEMVETEKQQEHELQQL
REHLAMLLGVLLEAKHLSLGPGPELSKAAELLRRCEALERKTATFENIVCVLNREVERVA
MTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMADLEQKVHEMEASTFDGVFIWK
ISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGP
NDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSK
MEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggctgcagccagcgtgacccctcccagctccctagacgtgctgcagcccggcttctcc
aagactctcctggggaccaagctggaggacaagtacctgtgctcggcctgtaagaatgtc
ctgcgcaggcccttccaggcgcagtgtggccaccgctactgttccttctgtctgagcagc
atcctcagctccgggccccagaactgtgctgcctgtgtgcacgagggaatatacgaggaa
ggcatctccatcttagagagcagctcggcgttcccagacaatgctgcccgcagggaggtg
gagagcctgccagccatctgccccaccgatggctgtacttggaaggggaccctcaaggag
tacgagagttgccatgaaggacactgcccgttcatgctgaccgagtgcccggcgtgcagg
ggcctggtgcgcctgtgcgagaaggcacgccacgtggagcaggagtgccccgggaggagc
ctcagctgcccgcactgccgggccccctgctgctgggccgacgtgacggcgcaccacgag
gtctgccccaagttccccttgacttgcgatggctgtggcaagaagaagatcccacgtgag
aagtttcaggaccacatcaggacctgcggcaagtgcccagtgccctgtcggtttcacgaa
gtcggctgccccgagatggtggagaccgagaagcagcaggagcacgaactgcagcagctc
cgggagcacctggccatgctgctgggcgtactcctggaggccaagcacctgtccctgggc
ccagggccagagctctccaaggctgcggagctcctgcggaggtgtgaggccttggagagg
aagactgccacctttgagaacattgtgtgtgtcctgaaccgggaggtggagagggtggcc
atgactgctgaggcctgcggccggcagcaccggctggaccaagacaggattgaagccctg
agtaataaggtgcagcagctggagaggagcatcggcctgaaggacctggcaatggccgac
ctggagcagaaggttcatgagatggaggcatccaccttcgatggggtgttcatctggaag
atctcggacttcgccaggaagcgccaggaggctgtggctggccgcataccagccatcttc
tccccagccttctacaccagcaggtacggctacaagatgtgcctgcgtgtgtacctgaat
ggggatggcaccgggcgtggcacacacctgtctctcttctttgtggtgatgaaaggcccc
aacgacgccctcctgcgctggcccttcaaccaaaaggtgaccctcatgttgcttgaccag
aacaaccgggagcatgtgattgatgccttcagacccgatgtgacctcatcttctttccag
cggccagtcagtgacatgaacattgcaagcggctgccccctcttctgccctgtctccaag
atggaggccaagaattcctatgtgcgggatgatgccatcttcatcaaggccatcgtggac
ctgacagggctctag

DBGET integrated database retrieval system