KEGG   Miniopterus natalensis (Natal long-fingered bat): 107536276
Entry
107536276         CDS       T05883                                 
Symbol
SEL1L2
Name
(RefSeq) protein sel-1 homolog 2
  KO
K14026  SEL1 protein
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107536276 (SEL1L2)
SSDB
Motif
Pfam: Sel1 DUF6686 SWI-SNF_Ssr4_C
Other DBs
NCBI-GeneID: 107536276
NCBI-ProteinID: XP_016067421
LinkDB
Position
Unknown
AA seq 590 aa
MVICKPGREPLPEPDHAGTLDLDFQPAELNVFYIVDIEAERHNKKQKQRNVTTKIPVNEI
SQFLSYILERRKLVKIINKRENLLEKKKNQHKLRIKGIQNKDLLKSNQNYLKKQAKKNLT
EEGDQLFKMGIRILQQSKSQKQKAQAYTLFAKAADMGNLKAMEKMADALLFGNFGMQNIT
AAIQLYESLAKEGSYKAQNALGFLSSYGIGMEYNQAKALIYYTFGSAGGSMMSQMILGYR
YLSGINVLQNCEAALYHYKKVADYIADKLEKSEGIPVEKVRLTERPENLSSNSEILDWDI
YQYYKFLAERGDVHIQVSLGQLHLIGRKGLDQDYYKALYYFLKAAKAGSANAMALIGKMY
LEGNDAAPQNNATAYKYFSMAANKGNAIGLHGLGLLYFYGKGVPVNYAEALKYFQKAAEK
GWPNAQFQLGFMYYSGSGVWKDYKLAFRYFYLASQSGQPLAIYYLAEMYATGTGVLRSCR
TAVEKRLELLKKRRCIQWHYYCGIELPFKDIHLARRLYDMAAQTSPDAHMPVFFALMKLE
TVHLFRDILFLNHFTVRWIKLDDALGPYWDYFAMGLIVAVLIYLLRNRYG
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggtcatctgcaagccagggagagagcctttaccagaaccagaccatgctggcaccctg
gacttagactttcagcctgcagaactaaatgttttctatattgtagatattgaagcagaa
agacataataaaaaacaaaaacaaagaaatgtcaccacaaagataccagtgaatgaaatc
agtcaatttttatcgtatatattggaacgaagaaaattggtcaaaataatcaataaaaga
gaaaatctcttagaaaaaaagaagaatcaacataaattaagaataaaaggaattcaaaat
aaagatctcttgaaaagtaatcaaaattatttaaaaaagcaggcaaagaaaaatctcaca
gaggaaggagaccagctatttaagatgggcatcaggattctccaacagtctaaaagtcag
aaacaaaaagcacaagcctacacactctttgccaaagcagctgacatgggaaacttgaaa
gctatggagaaaatggctgatgctttgctatttggaaattttggcatgcaaaacataaca
gcagctatccaattatatgagtccctggccaaggaaggatcatataaagcccaaaatgca
ttgggatttttgtcttcttatggaataggaatggaatataatcaagccaaggcactgata
tattacacctttggaagtgctggaggaagcatgatgtcccagatgatattggggtacaga
tatttatcaggaatcaatgttctacagaattgtgaagctgccctatatcattacaagaaa
gtggcagattatattgctgacaaattggaaaaaagtgaaggtattccagtggaaaaagtg
agactaactgagagacctgaaaatctgagttctaacagtgagattctggattgggacata
taccaatactataaatttctggccgaaagaggagatgttcatatacaagtatctcttgga
cagttacatctaattgggaggaaaggtctagatcaggattactataaagcattatactac
ttcttaaaggcagcaaaggccgggagtgcaaatgccatggcactcataggaaagatgtat
ttggaaggtaatgatgcagcaccacaaaataatgctactgcttacaaatacttctccatg
gcagccaataagggtaatgcaattggtcttcatgggcttggtcttctttacttttatgga
aaaggagttcctgtgaattatgctgaagcacttaaatactttcagaaagctgcagagaaa
ggatggcccaacgcacagtttcagttaggcttcatgtactactctggctctggagtatgg
aaggattataaacttgccttcagatatttttacttggcatctcagagtgggcagcccctc
gccatttattacctggctgagatgtacgcaacaggaacaggagtgttaagatcatgcaga
actgctgtggagaaaaggctagaattattgaaaaagagaagatgtatccaatggcactac
tactgtggaatcgagctgccattcaaggacattcacttggccaggagattatatgatatg
gctgctcaaacaagtcctgacgctcacatgcctgtcttctttgctctcatgaaactggaa
acggtgcatttgttccgagatatcctgtttttaaatcactttacagtgagatggataaaa
ttggacgatgcacttgggccatactgggattactttgcgatgggcctgattgttgctgtg
ttgatctacttgcttagaaatcgctacgggtag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107542633
Entry
107542633         CDS       T05883                                 
Symbol
SEL1L
Name
(RefSeq) protein sel-1 homolog 1
  KO
K14026  SEL1 protein
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107542633 (SEL1L)
SSDB
Motif
Pfam: Sel1 fn2
Other DBs
NCBI-GeneID: 107542633
NCBI-ProteinID: XP_016075523
LinkDB
Position
Unknown
AA seq 794 aa
MRVRVGLTLLLCAVLLGTASASSDEEGSQDESLDSKTSLPSDESVKDHSTAGRVVAGQIF
LDSEEAELESPVQEEEDSPRSQEGESGTEEISFLESLNPENKDYEEPTKVQKPALTAIEG
TAHGAPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEATKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLTQNIQ
AAKQMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMILGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFSLAANAGNSHAMAFLGKMY
SEGSDTVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
NAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
EATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQY
IRETNIRDIFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPAPRPPGPRPA
PPPQDVPPEQPPPQ
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgcgggtccgggtcgggctgacgctgctgctctgtgcggtgctgctgggcacggcctcg
gcgtcttcggatgaagaaggcagccaggatgaatccttagattccaagacttctctgcca
tcagatgagtcggtaaaggaccacagtacagcaggcagagtagtcgctggtcagatattt
cttgattcagaagaagcagaattggaatcacctgttcaggaggaggaagacagccccagg
agccaagaaggagaaagtggcacagaagaaatcagttttctagaatctttaaatccagaa
aacaaggattatgaagagccaacgaaagtacagaaaccagctttgacagccattgaaggc
acagcacatggggcaccctgccacttcccttttcttttcctggataaggaatatgacgag
tgtacctcagatgggagggaagatggtaggctgtggtgtgctacaacctatgactacaag
gcagatgaaaagtggggcttttgtgaaactgaagaagaggctactaaaagacggcaaatg
caggaagcagaaatgatgtaccagactgggatgaaaatcctcaatggaagcaataagaaa
agccaaaaaagagaagcatatcggtatcttcaaaaggcagcaagcatgaaccataccaag
gccctggagagagtgtcatatgctcttttgtttggtgattacctgacacagaacatccag
gcagctaaacagatgtttgagaagttgactgaggaaggctctcccaagggacagactgcc
cttggctttctctatgcctccggacttggtgttaattcaagtcaggcaaaggcccttgta
tattatacttttggagctcttggaggcaacttaatagcccacatgattttgggttaccgc
tactgggccggcattggagtcctgcagagttgtgaatccgcactgactcattaccgtctc
gtcgccaatcatgttgctagtgacatctcactgacaggaggctccgtagtacagagaata
cggctgccagacgaggtggaaaacccagggatgaacagtgggatgctagaggaagatttg
attcagtattaccagttcctggctgaaaagggggatgtgcaagcacaggtcggtctggga
caactgcacctgcatggagggcgtggagtggaacagaatcatcagagagcgtttgactac
ttcagtctagcagctaatgctggcaactcacatgctatggccttcttgggaaagatgtac
tcagagggaagtgatactgtgccccagagcaatgagacagcgcttcactactttaagaaa
gcggctgacatgggcaacccagttggacagagtgggctcggaatggcttacctctatggg
agaggagttcaagttaattatgatctggcactgaagtacttccagaaagctgctgagcaa
ggttgggtggatgggcaactccagcttggctctatgtattataatggcattggagtcaag
agggattataaacaggccttgaagtattttaacttggcttctcagggaggccatatcttg
gctttctataacctggcacagatgcacgccagtggcaccggtgtgatgcgatcgtgccac
aatgcagtggagttgtttaagaatgtatgtgaacggggccgttggtccgagaggcttatg
actgcctataacagctataaagatggcgattacaacgccgcagtgatccagtacctcctg
ctggccgaacaaggctatgaagtggcacagagtaacgcagccttcattctcgaccagaga
gaagcaaccattgtaggtgagaatgaaacgtaccccagagctttgctgcactggaacagg
gccgcctctcaagggtacacggtggctagaatcaagcttggagactaccatttctatggc
ttcggcaccgacgtagattacgagactgcatttattcattatcgcctcgcgtctgagcag
caacacagtgcacaagctatgtttaatctgggatatatgcatgagaaaggactgggcatt
aaacaggatattcaccttgcaaaacgtttttatgacatggcagccgaggccagcccagat
gcacaagtaccagtcttcctagcactctgcaaattgggtgtcgtctatttcttgcagtac
atacgagaaacaaatattcgagatatattcacccagcttgatatggaccagcttttggga
cccgaatgggacctttacctcatgactatcattgcattgctgctgggaacagtgatagct
tacaggcagaggcagcaccaggacatgcctgcgcccaggccgccggggccacggccagca
ccgccgccacaggacgtgcccccggagcagccaccaccacagtaa

DBGET integrated database retrieval system