KEGG   Miniopterus natalensis (Natal long-fingered bat): 107537267
Entry
107537267         CDS       T05883                                 
Symbol
UBQLN2
Name
(RefSeq) ubiquilin-2
  KO
K04523  ubiquilin
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107537267 (UBQLN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107537267 (UBQLN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107537267 (UBQLN2)
   03051 Proteasome [BR:mna03051]
    107537267 (UBQLN2)
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107537267 (UBQLN2)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    107537267 (UBQLN2)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD YukD Rad60-SLD_2 Ubiquitin_5 Dsc3_N ATG8 CUE HOIP-UBA
Other DBs
NCBI-GeneID: 107537267
NCBI-ProteinID: XP_016068732
LinkDB
Position
Unknown
AA seq 624 aa
MAENGESSGPPRPSRGPAAAQGSASAQAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSTAAG
TNTTTASTPRSNSTPISTNSNPFGLGSLGGLASLSSLGLSSTNFTELQNQMQQQLLSSPE
MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARN
PAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS
SGEGTQPSRTENRDPLPNPWAPPPATQSSATTGTTTSSGSGSSSSSSSATGNTMAAANYV
ASIFSTPGMQSLLQQITENPQLIQNMLSAPYVRSMMQSLSQNPDVAAQMMLNTPTFAGNP
QLQEQIRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLASEAPGLIPSFTPGV
GVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAGPPGSTGSGSTPGPTMPS
SASSETTSPTSESGPNQQFIQQMVQALAGANPPQLPNPEVRFQQQLEQLNAMGFLNREAN
LQALIATGGDINAAIERLLGSQPS
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggctgagaacggcgagagcagcggccccccgcgcccctcccgcggccctgctgcggcc
caaggctctgcctctgcccaggccgagcccaaaataatcaaagtcactgtgaagaccccc
aaagagaaagaggagttcgcggtgcccgagaatagctcagtgcagcagtttaaggaagcg
atttcgaaacgcttcaaatcccaaacggatcagctagtgctgatttttgccggaaaaatc
ttaaaagatcaagataccttgatccagcacggcatccatgatggactgaccgttcacctt
gtcatcaaaagccagaaccgaccccagggccagtccacacagcccagtactgccgcggga
actaatactactaccgcgtcgactcccaggagtaactccacacctatttccacaaatagc
aacccgtttgggttggggagcctgggaggacttgcaagccttagcagcctgggtttgagc
tcgaccaacttcaccgagctccagaaccagatgcagcagcagctcctgtccagccctgag
atgatgatccaaatcatggaaaatccctttgttcagagcatgctttcgaatcccgatctg
atgaggcagctcattatggcgaatccacagatgcaacaattgattcagagaaacccagaa
atcagtcacctgctcaacaacccagatataatgaggcagaccctcgaaatcgccaggaat
ccagccatgatgcaagagatgatgagaaatcaagacctggctctcagcaatctcgaaagc
atcccagggggctataatgccctacggcgcatgtacactgacattcaagaaccgatgctg
aatgctgcacaagagcagtttgggggtaatccgtttgcctccgtggggagcagttcctcc
tccggggaaggtacgcagccttcccgcaccgaaaatcgagatccgctacccaatccttgg
gcaccaccaccggctactcagagttctgcaaccacgggcacaactacgagcagtggcagc
gggtctagcagcagctccagtagtgctactgggaacactatggccgctgccaattatgtt
gccagcatcttcagcaccccaggaatgcagagcttgctgcaacagataactgaaaacccc
cagctgatccagaatatgctgtctgcgccctacgtgagaagcatgatgcagtcgctgagc
cagaatccagatgtggctgcacagatgatgctgaatacccctacgtttgctggaaatcct
cagctacaggagcagattcgtccacagctccctgctttcctacagcagatgcagaatcca
gacacgctgtcagccatgtcaaacccaagagcaatgcaggctttaatgcagatccagcag
gggctacagacattagcctctgaagctcctggcctcattccaagcttcactccaggtgtg
ggggtgggggtgctgggaaccgctataggccctgtaggcccagtcacgcccataggtccc
ataggccccatagtgccatttacccccattgggcccattgggcccataggacccactggc
cctgcaggtcctcctggctccactggttctggcagcacccctgggcccaccatgcctagc
tctgcatccagtgaaaccacgagcccaacatcagaatctggacccaaccagcaattcatt
cagcaaatggtgcaggctctggctggagcaaatcctcctcagctgccaaatccagaagtc
agatttcagcaacaactggaacagctcaacgcaatggggttcttaaaccgtgaagctaac
ttgcaggctctaatagcaacaggaggcgacatcaatgcagccattgagaggctgctgggc
tcccagccatcctaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107538694
Entry
107538694         CDS       T05883                                 
Name
(RefSeq) ubiquilin-3-like
  KO
K04523  ubiquilin
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107538694
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107538694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107538694
   03051 Proteasome [BR:mna03051]
    107538694
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107538694
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    107538694
SSDB
Motif
Pfam: ubiquitin UBA Rad60-SLD STI1 Ubiquitin_5 Dsc3_N Rad60-SLD_2 YukD HOIP-UBA
Other DBs
NCBI-GeneID: 107538694
NCBI-ProteinID: XP_016070501
LinkDB
Position
Unknown
AA seq 653 aa
MAKSGEALPQGSLAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKKEISQRFKAHPDQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTISTESPAASVPTPAPRSLLQPSS
IYPTDGPSTFSLGLLTGLSGLGLTSGSFLDQPSSLMWQHVSVPEFVAQIIDEPFLQGLMS
NTGLVSQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQTLEFLRNPAMMQEMMRSQDRALS
NLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFAAATSANATTNSSQPSRTENCDPL
PNPWAATNGGSGGRRGRWPGDQDISEIRNRVPNILGSIGLYDYLQQLHESPQSLGTYLQG
TASTLSPSQEAPPPGNQVPPTSPSSQKPEAGQPLPKESVTIKGKSSCPAFLRYPTESSPR
QNGSQDCARNGSTGHSTSMPDLLSELGVAANRAPFVPSPHSPMVATPGISEHSWLPPPAY
PRSPRPASMNQAPLLQDEIRRQLPLLLHLQAAMANPRAMRALLQIEQGLQVLATEAPHLL
LWFMPCLAGLGNMAGGVEAREDTLMPEAPSPAPVPEIPPEQGSVDLGLHSAPFLQILQAL
ASANSQQLQPEAHFRVQLEQLRAMGFLNSEANLQALIATGGDVDAAVEKLRES
NT seq 1962 nt   +upstreamnt  +downstreamnt
atggccaaaagcggagaggccctgccacagggcagtctagcaccagtccaggatccccac
ctcatcaaagtgacagtgaagacgcctaaggacaaggaggatttctcagttacagacact
tgcactatccagcagctgaagaaagagatatctcagcgctttaaggctcaccctgatcag
ctggtcttaatctttgctggcaaaatcctcaaggaccctgactcactggcacagtgtgga
gtgagagatggcctcactgtccacctggtcatcaagatgcagcgccgtaccataagcact
gagtccccagctgcttcagtccctactccagcccctcgatctcttcttcagccaagctct
atttacccaacagatgggccatccacctttagcttaggtctcctcacaggtctcagtggg
ctgggcctgacttctggtagtttccttgaccagccaagttcactgatgtggcagcatgta
tctgtgcctgagtttgtggctcagattattgatgagcctttcctccagggtctgatgtca
aacacaggcctggtgagccagctggtccttgacaacccccatatgcagcagctgatccag
cacaacccggagattgggcatattctcaacaaccccgaaatcatgcggcagacactggag
tttttacgtaaccctgccatgatgcaagagatgatgcgtagccaggaccgggcactcagt
aacctggagagcattcctggtggctacaatgtgcttcggaccatgtacacagatattatg
gacccaatgcttaatgctgtacaggagcagtttggtggcaatccctttgctgctgccact
tctgctaatgctaccactaacagcagccaaccttcaaggacagagaactgtgaccctctt
cccaacccctgggctgccacaaatggaggctcaggtggcaggcggggcaggtggcctggg
gaccaggacatatctgaaattagaaatagggttcccaacattctgggtagtataggactc
tatgactatctccaacaattacacgagagtccccagtccctgggaacctacctgcagggg
actgcatccaccctcagtccaagccaagaagcaccaccaccaggaaaccaagttccccca
acttcaccctcatcccagaaacctgaggcaggccagccactccccaaggagtcagtaaca
atcaaaggcaagtcctcttgcccagcattcttgagataccccacagagagtagtcctaga
cagaatggaagccaagattgtgcaaggaatgggtccactggtcacagtaccagcatgcct
gatcttctctcagagctgggagttgctgccaacagggccccatttgttccttccccacat
tccccaatggtggctacccctggaatctctgagcattcctggctgccgccaccagcttat
ccaagatctccgcggccagccagcatgaatcaggccccactgttgcaggatgagatacgt
cggcagctgcccctgcttctgcatcttcaggcagccatggcgaaccctcgtgccatgcgt
gccctgctgcagattgagcagggtctacaggtcctggcaactgaagcacctcacctccta
ctctggttcatgccttgcctagctgggctggggaatatggcaggaggtgtagaggctaga
gaggatacccttatgcctgaggctccctcaccagccccagttcctgagattcccccagaa
cagggctctgtggatctaggcctccattctgctccttttctccaaatactacaggcccta
gctagtgccaattcccagcagctgcagcccgaggctcacttccgggtgcagctagaacaa
ctgcgggccatgggctttctgaattctgaagccaatctccaggccctcatcgccacagga
ggtgatgtagatgcagcggtggaaaagctgagggagtcatag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107543839
Entry
107543839         CDS       T05883                                 
Name
(RefSeq) ubiquilin-4 isoform X1
  KO
K04523  ubiquilin
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107543839
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107543839
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107543839
   03051 Proteasome [BR:mna03051]
    107543839
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107543839
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    107543839
SSDB
Motif
Pfam: TRAP_beta STI1 RICTOR_V
Other DBs
NCBI-GeneID: 107543839
NCBI-ProteinID: XP_016077012
LinkDB
Position
Unknown
AA seq 565 aa
MPASPATPAQPSTSGSATSDAGSGSRRSSGGGPSPGAGEGPPNATTSILSGFGGILGLGS
LGLGSANFMELQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLME
RNPEISHMLNNPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQ
EPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGT
GGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMM
QTLAQNPDFAAQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALL
QIQQGLQTLQTEAPGLIPSLGSFGMSRTLAPSASSNTRPAPEAPASSPAPPASSPTGASN
AQQQLMQQMIQLLAGSGNSQMRLLAFVVLALSAATQAEEGARLLASKSLLNRYAVEGRDL
TLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPYPLDTGLALPVHLDR
EESLLSGSLIEDSHLTFWTGQPSGS
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcctgcttcacctgccacccctgcccagccctctacctctggcagtgccacttcggat
gctggcagtggaagccggaggagcagtggggggggtccctccccaggggctggggagggc
cctcccaatgctaccacatccatactctctggctttgggggcatcctaggcctgggcagc
ctgggtctgggctctgccaacttcatggagctgcaacaacagatgcagaggcagctgatg
tccaatcccgagatgctgtcgcagatcatggagaaccccctggtccaggacatgatgtct
aaccctgacctgatgcgccacatgatcatggccaacccccagatgcagcagctgatggag
cggaaccctgagatcagccacatgctcaacaaccccgagctcatgaggcagacgatggag
cttgctcggaatccagccatgatgcaggagatgatgcggaaccaggaccgggcccttagc
aacctggagagcatccctggagggtataatgccctccgccgcatgtacactgacatccag
gagcccatgttcagtgctgcccgggaacagtttggcaacaatcccttctcttccctggcc
gggaactccgacagctcgtcttcccagcctctgcggactgagaatcgagagcccctccct
aatccctggagcccctcgccccccacctcccaggcccccgggtccggtggggagggcacc
ggaggatcggggaccagccaggtgcacccgacagtctcgaacccctttgggatcaatgcg
gctagcctggggtcagggatgttcaacagcccggagatgcaggccctgctccagcagatc
tcagagaacccccagctgatgcagaacgtgatctctgccccctacatgcgtagcatgatg
cagacgcttgcccagaaccctgactttgccgctcagatgatggtgaacgtgccgctcttc
gcggggaacccccagcttcaggagcagctccgcctgcagctcccagtcttcctgcagcag
atgcagaacccagagtcactctccatccttaccaatccccgcgccatgcaggcgctgctg
cagatccagcagggattgcagaccttgcagactgaagcccccgggctgatacccagcctt
ggatcctttgggatgtcccggacccttgcaccatcagcaagcagcaacaccaggcctgcg
cccgaggcccctgcctcctcaccagccccaccagccagttctccaactggggcttccaat
gctcagcagcagctcatgcagcagatgatccagcttttggcaggaagtggaaactcacag
atgaggctgctggcatttgtcgtgttggctctatctgctgccactcaagcagaggaagga
gccaggcttttggcctccaaatcactgctgaacagatatgccgtggaggggagagacctg
accttacagtacaacatctacaatgttggctcaagtgctgcattagatgtggaattatct
gatgattccttccctccagaagactttggcattgtctctggaatgctcaacgtcaaatgg
gaccggattgccccgtatcctcttgacactggattggctttaccagtgcacctggacagg
gaggaatccttgctcagcgggagtttgatagaagattctcacctcactttctggactggg
cagccttcggggtcatga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107544952
Entry
107544952         CDS       T05883                                 
Symbol
UBQLN1
Name
(RefSeq) ubiquilin-1 isoform X1
  KO
K04523  ubiquilin
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107544952 (UBQLN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107544952 (UBQLN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544952 (UBQLN1)
   03051 Proteasome [BR:mna03051]
    107544952 (UBQLN1)
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107544952 (UBQLN1)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    107544952 (UBQLN1)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD YukD Rad60-SLD_2 Ubiquitin_5 Dsc3_N ATG8 CUE HOIP-UBA
Other DBs
NCBI-GeneID: 107544952
NCBI-ProteinID: XP_016078398
LinkDB
Position
Unknown
AA seq 588 aa
MADSGESGGPPSSQDSAAGAEGTGAPAAAASTEPKIMKVTVKTPKEKEEFAVPEDSSVQQ
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSSQQT
NTSGSNVTTSTAPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNSTNFSELQSQMQRQLM
NNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASLV
SNTSSGEGSQPSRTENRDPLPNPWAPQASQSSSASSGTTNAVGGTGGNTASSTPGQSSAP
SLGPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNN
PLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLI
PGFTPGLGALGSTGGSSGTNGSSSAPSENPSPTAGTTEPGHQQFIQQMLQALAAVNPQLQ
NPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggccgatagtggtgaaagcggtggccctccgagctcccaggacagcgccgccggagcc
gaaggtactggcgcccccgcagccgctgcttctacggagcccaagatcatgaaagtcact
gtgaagaccccgaaagagaaggaggagttcgctgtgcccgaggatagctctgtccagcag
ttcaaggaagaaatctctaaacggttcaaatcacatactgaccaacttgtattgatattt
gcgggaaaaattttaaaagatcaagatactttgagtcagcatggaattcacgatggactt
actgttcaccttgtcatcaaaacgcaaaacaggcctcaggatcattcatcccagcaaaca
aataccagcggaagcaatgttaccacatctacagctcctaatagtaactccacatctggt
tctgccactagcaacccttttggtttaggtggccttggaggacttgcaggtttgagtagc
ttgggtttgaattctaccaacttctctgaactacaaagccagatgcagcggcaacttatg
aacaatcctgaaatgatggtccagatcatggagaatccctttgtccagagcatgctttca
aatcctgacctgatgaggcagttaattatggccaatccacaaatgcagcagttgattcag
agaaatccagaaattagtcatatgctgaataatccagatattatgagacaaacattggaa
cttgccaggaatccagcaatgatgcaggaaatgatgagaaaccaggaccgagccttgagt
aacctggaaagcattccagggggatacaatgctttacggcgcatgtacacggatattcag
gaaccgatgctgaatgctgcacaagaacagttcggtggtaatccatttgcttccttagtg
agcaatacatcctcaggtgaaggtagtcaaccttcccgtacagaaaatagagatccatta
cccaatccatgggctccacaggcttcccagagttcatcagcttctagtggcaccaccaac
gctgtggggggcactggtggtaatactgcgagcagcactcctgggcagagttctgcacca
agtttggggcctggagtaggagctagtatgttcaacaccccaggaatgcagagcttgttg
caacaaataactgaaaacccacaacttatgcaaaacatgttgtctgccccatatatgaga
agcatgatgcagtcactaagccagaaccctgaccttgctgcacagatgatgctgaataat
cccctatttgctggaaatcctcagcttcaagaacaaatgagacaacagctcccaactttc
ctccaacaaatgcagaatcctgatacattatcggcaatgtcaaaccctagagcaatgcag
gccttgttgcagattcagcagggtttgcagacattagcaacagaagcacccggcctcatc
ccagggtttactcctggccttggggcattaggaagcactggaggctcttcaggaaccaat
ggctctagctctgctcctagtgaaaacccaagtcccacagcaggaaccacggagcctgga
caccagcagtttatccaacaaatgctgcaggctcttgctgcagtaaatcctcagctacag
aatccagaagtcagatttcaacaacaactggaacaactcagtgcaatgggatttttgaac
cgtgaagcaaacttgcaggcgctgatagcaacaggaggtgatatcaatgcagctattgaa
aggttactgggctcccagccatcatag

DBGET integrated database retrieval system