KEGG   Miniopterus natalensis (Natal long-fingered bat): 107537666
Entry
107537666         CDS       T05883                                 
Symbol
RAD23B
Name
(RefSeq) UV excision repair protein RAD23 homolog B
  KO
K10839  UV excision repair protein RAD23
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03420  Nucleotide excision repair
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107537666 (RAD23B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    107537666 (RAD23B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mna03051]
    107537666 (RAD23B)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107537666 (RAD23B)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    107537666 (RAD23B)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      107537666 (RAD23B)
SSDB
Motif
Pfam: UBA XPC-binding UBA_3 UBA_2 DUF1421
Other DBs
NCBI-GeneID: 107537666
NCBI-ProteinID: XP_016069226
LinkDB
Position
Unknown
AA seq 335 aa
MVTKPKAVTTPAPATTQQSNSATTTTVSSSTAPAVAQVPTPTPALAPTPTPASITPASTT
ASSEPAPASTTKQESPAEQPAETPVATSPTSTDSTSDSSRSNLFEDATSALVTGQSYENM
VTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPPAASTGPPQSS
VAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLL
QQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGVAEAGSGHMNYIQVTPQEKEAIERLK
ALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggtgacaaaacccaaagcagtgacaacaccagcaccagcaacaactcagcaatcaaat
tctgccaccacaaccacagttagttcctccacagcaccagctgtggctcaggtcccaacc
cccacccctgctttggctcccactcccacacctgcatctatcactccagcatcaacgaca
gcatcgtctgaacctgcacctgctagtacaacaaaacaggagagccctgcagaacagcca
gcagaaacaccagtggctactagcccaacatcaactgacagtacatcagattcttctcgg
tcaaacctttttgaagacgcaacaagtgctcttgtgacaggtcagtcttacgagaatatg
gtaactgagatcatgtccatgggctatgaacgagagcaagtaattgcagccctgagagcc
agtttcaacaaccctgacagagcagtggagtatcttttaatgggaatccctggagacaga
gaaagtcaggctgtggttgatccccctccagcagctagtactgggcctcctcagtcttca
gtggctgcggctgcagcaacgacgacagcaacgactacaacaacaagttctggaggacat
ccccttgaatttttgcggaatcagcctcagtttcaacagatgagacaaattattcaacag
aatccttccctgcttccagcattgctacaacagataggtcgagaaaatcctcagttactg
cagcaaattagccaacaccaggagcattttattcagatgttaaatgaaccagttcaagaa
gctggtggtcaaggaggagggggcggaggtggcagtggaggagttgcagaagctggaagt
ggtcatatgaactacattcaagtaacgcctcaggaaaaagaagctatagaaaggttaaag
gcattaggatttcctgaaggacttgtgatacaagcatattttgcttgtgagaagaatgag
aacttggctgccaattttcttctacagcagaactttgatgaagattaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107541513
Entry
107541513         CDS       T05883                                 
Symbol
RAD23A
Name
(RefSeq) UV excision repair protein RAD23 homolog A
  KO
K10839  UV excision repair protein RAD23
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03420  Nucleotide excision repair
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107541513 (RAD23A)
  09124 Replication and repair
   03420 Nucleotide excision repair
    107541513 (RAD23A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mna03051]
    107541513 (RAD23A)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107541513 (RAD23A)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    107541513 (RAD23A)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      107541513 (RAD23A)
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin UBA_3
Other DBs
NCBI-GeneID: 107541513
NCBI-ProteinID: XP_016074089
LinkDB
Position
Unknown
AA seq 371 aa
MAVTITLKTLQQQTFKIHEAPPPGRLPGPGSNVKVLKEKIEAEKGRDAFPVAGQKLIYAG
KILSDDVPIRDYRIDEKNFVVVMVTKAKNSSGTSVPPEASSTAAPESSTSFLPAPASGMS
HPPPTVREDRSPSEESVPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMS
MGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEPAGENPL
EFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELA
DISDIEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAA
NFLLSQNFDDE
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggccgtcaccatcacgctcaagacgctgcagcagcagacctttaagatccacgaggcc
ccacccccggggcgcctgccaggccctgggtctaatgtgaaggtgctaaaggagaagata
gaagctgaaaagggtcgtgatgccttccctgtggctggacagaaactcatttatgctggc
aagatcctgagtgatgacgtccccatcagggactatcgaatagatgagaagaactttgtt
gttgtcatggtgaccaaggccaaaaacagctcaggcacctcagtacccccagaagcctca
tccactgctgcccctgaatcctccacatccttcctgccggcccctgcctcaggcatgtcc
catccgccacctaccgtcagagaagacaggagtccatcggaggaatcagtccccacgaca
tccccggagtctgtatcaggctctgttccttcttcaggtagcagcgggagagaggaagac
gcagcctccacactagtgactggctctgaatatgagacgatgctgacggagatcatgtcc
atgggctatgagcgggaacgggttgtggcagccctgagagccagctacaacaacccccac
cgagctgtggagtatctactcacgggaattcctgggagtcccgagccagaacacggttct
gtccaggagagccaggtgtctgagcagccggccacagaaccagcgggagaaaaccccctg
gagttcctgcgggaccagccccagttccagaatatgcggcaggtgattcagcagaatccg
gccctgctacctgccctgcttcagcagctgggccaggagaacccacagcttctgcagcaa
atcagccggcaccaggagcagttcatccagatgctgaatgagccccctggggagctggcg
gacatctctgacattgagggtgaggtgggtgccataggggaggaggccccacagatgaac
tacatccaggtgacgccgcaggagaaggaagctatagagaggttgaaggccttgggcttc
ccagagagcctggtgatccaggcctacttcgcctgtgaaaaaaatgaaaacttggctgcc
aactttctcctgagtcagaactttgatgacgagtga

DBGET integrated database retrieval system