KEGG   Miniopterus natalensis: 107537877
Entry
107537877         CDS       T05883                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04620  Toll-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04940  Type I diabetes mellitus
mna05133  Pertussis
mna05134  Legionellosis
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05162  Measles
mna05164  Influenza A
mna05168  Herpes simplex virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05321  Inflammatory bowel disease
mna05330  Allograft rejection
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107537877 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107537877 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107537877 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    107537877 (IL12B)
   04625 C-type lectin receptor signaling pathway
    107537877 (IL12B)
   04658 Th1 and Th2 cell differentiation
    107537877 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537877 (IL12B)
   05205 Proteoglycans in cancer
    107537877 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107537877 (IL12B)
   05164 Influenza A
    107537877 (IL12B)
   05162 Measles
    107537877 (IL12B)
   05168 Herpes simplex virus 1 infection
    107537877 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107537877 (IL12B)
   05134 Legionellosis
    107537877 (IL12B)
   05152 Tuberculosis
    107537877 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107537877 (IL12B)
   05145 Toxoplasmosis
    107537877 (IL12B)
   05140 Leishmaniasis
    107537877 (IL12B)
   05142 Chagas disease
    107537877 (IL12B)
   05143 African trypanosomiasis
    107537877 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107537877 (IL12B)
   05330 Allograft rejection
    107537877 (IL12B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107537877 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107537877 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107537877 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107537877 (IL12B)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107537877 (IL12B)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Cytokines
   107537877 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_3 fn3 Ig_5 Ig_2 Ig_4 I-set
Other DBs
NCBI-GeneID: 107537877
NCBI-ProteinID: XP_016069489
LinkDB
Position
Unknown
AA seq 329 aa
MQQQQSVFYCCSLVLLASPLVAIWELEKDVYVVELDWYPGAPGEMVVLTCDTPEEDGITW
TLNWSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGFWSTDILKDQ
KELKNKTFLKCEAKNYSGRFTCWWLTAISTDVKFSVKSSRGSSDPRGVTCGAATLSAERV
KVDHREYQKYTVECQEGSACPAAEESLPVEVVVDAVHGLKYENYTSSFFIRDIIKPDAPK
NLKIKPLKNSRQVEVSWEYPDTWSTPHSYFALKFSLQVQGKNKRERKDKLLEDKTSAKVT
CHKDAVIRVQAQDRYYSSSWSEWASVSCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcagcagcaacagtcggtcttctactgttgttccctggttttgctggcatctcccctc
gtggccatatgggaactggagaaagacgtttatgttgtagagttggattggtatcctggt
gcccctggagaaatggtggtcctcacctgcgatacccctgaagaagatggcatcacctgg
accttgaactggagcagtgaggtcttaggctctggcaaaaccttgaccatccaagtcaaa
gaattcggagatgctggccagtacacctgtcacaagggaggagaggtgctcagccattct
ctccttctgcttcacaaaaaggaagatggattttggtccacagatattttaaaggaccag
aaagaactcaaaaataagacctttctgaaatgtgaagcaaagaattattccggacgtttc
acctgctggtggctgacagcaatcagtactgatgtgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccggggagtgacctgtggagcagcaaccctctcggcagagagggtc
aaagtggaccacagggagtatcagaagtacacagtggagtgtcaggagggcagtgcctgc
ccagccgccgaggagagcctacccgttgaggtcgtagtggatgctgttcacgggctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccagatgcccccaag
aacctgaagataaagccattaaagaattcccggcaggtggaggtcagctgggaatacccc
gacacctggagcaccccacattcctactttgccctgaaattttctcttcaggtccagggc
aagaataagagagaaaggaaagataaactccttgaagacaagacctcagccaaggtcaca
tgccacaaggatgcagtgatccgtgtgcaagcccaagaccgctactatagttcatcctgg
agcgaatgggcatctgtgtcctgcagttag

KEGG   Miniopterus natalensis: 107539273
Entry
107539273         CDS       T05883                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04620  Toll-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04940  Type I diabetes mellitus
mna05133  Pertussis
mna05134  Legionellosis
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05144  Malaria
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05162  Measles
mna05164  Influenza A
mna05168  Herpes simplex virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05321  Inflammatory bowel disease
mna05330  Allograft rejection
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107539273 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107539273 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107539273 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    107539273 (IL12A)
   04625 C-type lectin receptor signaling pathway
    107539273 (IL12A)
   04658 Th1 and Th2 cell differentiation
    107539273 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539273 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107539273 (IL12A)
   05164 Influenza A
    107539273 (IL12A)
   05162 Measles
    107539273 (IL12A)
   05168 Herpes simplex virus 1 infection
    107539273 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107539273 (IL12A)
   05134 Legionellosis
    107539273 (IL12A)
   05152 Tuberculosis
    107539273 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107539273 (IL12A)
   05144 Malaria
    107539273 (IL12A)
   05145 Toxoplasmosis
    107539273 (IL12A)
   05140 Leishmaniasis
    107539273 (IL12A)
   05142 Chagas disease
    107539273 (IL12A)
   05143 African trypanosomiasis
    107539273 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107539273 (IL12A)
   05330 Allograft rejection
    107539273 (IL12A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107539273 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107539273 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107539273 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107539273 (IL12A)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107539273 (IL12A)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Cytokines
   107539273 (IL12A)
SSDB
Motif
Pfam: IL12 RHH_1
Other DBs
NCBI-GeneID: 107539273
NCBI-ProteinID: XP_016071183
LinkDB
Position
Unknown
AA seq 304 aa
MECGEKPERLLRALDQEDVGFMKTTEAIIGFYAQRIERAPDDENGTLMYFLRLHTETCQV
LSPCFCKRTCCFHQAYSPPPTPGSLWNHHLIRGLFLVVPLVLHLGLARSLPIATAGPAMF
PCVSHSQNLLKTVSHALQKAKQTLEFYSCTSEEIDHEDITKDRTSTVEACLPLELATNES
CLVSRGISLITNGSCLASRKASFMTTLCLSSLYEDLKMYQVEFKAINAKLLMDPKRQITL
DQNMLAAIDELMQALNFNSEAVPQKPSLEELDFYKTKVKLCILLHAFRIRAVTIDRMMSY
LSSS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggaatgtggagaaaagccggagagattactgagagccttagaccaagaagatgttgga
tttatgaagacaacagaggccattattggattttatgctcagagaatagagagagctcct
gatgatgaaaatggaacattaatgtacttcctacgcctacatacggagacctgccaggtg
ctgagcccctgcttttgcaagaggacgtgctgtttccaccaagcatattctccaccgccg
actcctggcagcctgtggaaccaccatctgatccgaggcctcttccttgtggtccccctg
gtcctacacctcggtctggccaggagcctgcccatagccacagcaggcccggcaatgttt
ccgtgtgtcagccactcccagaacctgctgaagaccgtcagccacgcgcttcagaaggcc
aaacaaactctagaattctactcctgcacttctgaagagatcgatcatgaagatatcaca
aaagatagaaccagcacggtagaggcctgcttaccactggaattagccacgaatgagagt
tgcctggtttccagagggatctctctcataactaatgggagttgcctggcatccagaaag
gcctcttttatgacgaccctgtgcctcagtagtctctatgaggacttgaagatgtaccag
gtagagttcaaggccataaatgcaaagcttctgatggatcctaagaggcagatcactctg
gatcaaaacatgctggcagctattgatgagctgatgcaggccctgaatttcaacagtgag
gctgtgccacagaaaccctcccttgaagagctggatttttataagacaaaagtcaagctc
tgcattctccttcatgctttcagaatccgtgcagtgaccatcgatcgaatgatgagctat
ctgagttcttcctaa

DBGET integrated database retrieval system