KEGG   Miniopterus natalensis: 107538711
Entry
107538711         CDS       T05883                                 

Gene name
TRIM21
Definition
(RefSeq) E3 ubiquitin-protein ligase TRIM21
  KO
K10651  tripartite motif-containing protein 21 [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis
Pathway
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107538711 (TRIM21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107538711 (TRIM21)
   04131 Membrane trafficking [BR:mna04131]
    107538711 (TRIM21)
   04121 Ubiquitin system [BR:mna04121]
    107538711 (TRIM21)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107538711 (TRIM21)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107538711 (TRIM21)
Membrane trafficking [BR:mna04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    107538711 (TRIM21)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    107538711 (TRIM21)
SSDB
Motif
Pfam: PRY SPRY zf-C3HC4 zf-C3HC4_4 zf-C3HC4_2 zf-B_box zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-RING_5 zf-RING_4 zf-RING_6 zf-RING_10 zf-rbx1 zf-Nse Prok-RING_4 U-box DUF4972 DZR_2
Other DBs
NCBI-GeneID: 107538711
NCBI-ProteinID: XP_016070523
LinkDB
Position
Unknown
AA seq 468 aa
MASEKPLAMMWEEVTCPICLDPTVEPVSIECGHSFCRECISQVAKAGGGTCPTCRKKFLT
KSFRPNLQLANMVENLRQISQNTKEGTQKEQCAVHGKRLHLFCETDGKALCWVCSQSRKH
RDHSMIPIEEAAEEYQEKLQEALKKLRKEQEFAEKLEMDVTMKRTAWKEKVETHKLRIHS
EFEQQKNFLVEEEQRQLQKLEKEEREQLRILGETEATLAQRCQALQELISELERRSQCSE
VELLQEVKSVLERSESWKLGELDIISPDLQSVCHVPGLKTMLRTCGAHVTLDPHTANPWL
IISEDKRQVRLGDTQQKVPENEKRFDTYPMVLGAQCFDSGKFYWEVDVTGKEAWDLGVCR
DSVKRKGHFILSPMNGFWTIWLWKKQKYEAGTCPQTPLHLSVPPHQIGIFLDYEASTVSF
YNITDHGSLIYTFSECAFTGPLRPFFNTGFNDGGRNEAPLTICPLRMG
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcctcagaaaagcccttggcaatgatgtgggaggaggttacatgccccatctgcctg
gatcccacagtggagcctgtgagcattgaatgtggtcacagcttctgccgcgaatgcatc
tctcaggtggcaaaagctgggggtggcacctgtcctacatgccggaagaagttcctgacc
aagagcttccggcccaatcttcagctagccaatatggtggagaacttaagacaaatcagc
caaaataccaaggagggcacacagaaggaacaatgtgcagtgcatggaaagaggcttcac
ctcttctgcgagacagatgggaaggctctttgctgggtgtgttcccagtcccggaaacac
cgtgaccactccatgatcccaattgaggaggctgctgaggagtaccaggagaagctccag
gaagcattaaagaaactgagaaaagagcaagagtttgctgagaagttggaaatggatgtt
acaatgaagagaacagcctggaaggagaaggttgagacacacaaattgaggattcactca
gagttcgagcagcagaaaaacttcttggttgaagaggaacagaggcaactgcagaagcta
gagaaggaagagagggaacagctgagaatcctgggggagacggaggccacgctggcccag
cgctgccaggccctacaggagctgatctcagagctggagaggagaagccagtgctcagag
gtggagctgctgcaggaggtgaaaagtgtcctggaaaggagtgagtcctggaaactggga
gagctggacatcatctccccagacctgcagagtgtgtgccatgtgccagggctgaagaca
atgctgaggacgtgtggagcacacgtcaccctggatccacacacagccaatccgtggctc
atcatttcagaggataaaagacaagtgaggcttggagacacccagcagaaggtgcctgaa
aatgagaagagatttgatacttatcccatggtcctgggtgcccagtgttttgactctgga
aaattttactgggaggtagatgtgacgggaaaagaggcctgggacctgggggtttgtaga
gactctgtgaagaggaaggggcattttatactcagccccatgaatggcttctggacaatt
tggctgtggaagaaacaaaaatatgaggctggcacctgcccgcagactcccctccacctt
tcggtgcccccacaccaaattgggatcttcctggattatgaagccagcaccgtctccttc
tacaacatcactgaccacggctccctcatctacaccttctctgaatgtgccttcaccggg
cccctgcggcctttcttcaatactggtttcaatgatggtggaagaaatgaggcccctctg
accatctgtcctctgaggatgggatga

KEGG   Miniopterus natalensis: 107543629
Entry
107543629         CDS       T05883                                 

Gene name
TROVE2
Definition
(RefSeq) 60 kDa SS-A/Ro ribonucleoprotein
  KO
K11089  60 kDa SS-A/Ro ribonucleoprotein
Organism
mna  Miniopterus natalensis
Pathway
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107543629 (TROVE2)
SSDB
Motif
Pfam: TROVE DUF2201 VWA_CoxE VWA_2
Other DBs
NCBI-GeneID: 107543629
NCBI-ProteinID: XP_016076696
LinkDB
Position
Unknown
AA seq 555 aa
MWQVTFCFLIGFLKDRKMEDSLNQMQPLNEKQVVNSEDGYVWQVTDMNRLHRFLCFGSEG
GTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKAFSQEGRTARQEPILFALAICSQCS
DISTKQAAFKAVAEVCRIPTHLFTFIQFKKDLKESMKCGIWGRALRKAIADWYNGKGGMA
LALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLTIVTKYITKGWKEVQELYKEKALSAETE
KLLKYLEAVEKVKRTKDELEVTHLIEEHRLVREQLLTNHLKSREVWKALLREMPLAALLR
NLGKMTANSVLEPGNSEVSLVCEKLRNDKLLKKARIHPFHVLIALETYRAGHGLRGKLKW
CPDEEILKALDAAFYKTFKTVEPTRKRFVLAVDVSASMDQRVLGSVLNASTVAAAMCMVV
ARTEKDSHIVAFSDEMVRCPVTRDMTLQQVLMAMNQIPAGGTDCSLPMIWAQKTNTAADV
FIVFTDNETFAGGVHPAIALRQYRKKMSVPAKLIVCGMTSSGFTIADPDDRGMLDVCGFD
TGALDVIRNFTLDVI
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgtggcaagtaacattttgctttttgataggtttcctaaaagatagaaaaatggaggac
tcactaaaccaaatgcaacccctgaatgagaagcaggtagtgaattctgaagatggatat
gtatggcaagtcacggatatgaatcgcctacaccggttcttgtgttttggttctgagggt
gggacttactatatcaaagagcagaagttgggccttgaaaatgccgaagctttgattaga
ttgattgaagatggcagaggatgtgaggtgatacaggaaatcaaagcatttagtcaagaa
ggcagaaccgccaggcaggagcctatactctttgcgttggccatttgttcccagtgctcc
gacataagcacaaagcaagcggcatttaaagctgtggctgaagtttgtcgcattcctaca
catctcttcacttttatacagtttaagaaagatctgaaggaaagcatgaaatgtggcata
tggggccgcgccctccggaaggctatagcagactggtacaatggaaagggcggcatggcc
cttgctctggcagttacaaagtacaaacaaaggaatggctggtctcacaaagatctgtta
agattgtcacatctcaaaccctccagcgaaggactcactattgtcaccaaatatattaca
aagggctggaaagaggtccaggaattgtataaggaaaaagcactttctgcggagacggaa
aagttgttaaagtacctggaggctgtggaaaaggtgaagcgcacaaaggatgagctggaa
gtgactcacctgatagaagagcacaggttggttagggaacagcttctgacaaatcactta
aagtctagagaggtgtggaaggctttgctacgggaaatgcctctggccgcattgctaagg
aacctggggaagatgacagccaactcagtgcttgaaccaggaaattcagaagtgtctttg
gtgtgtgaaaaactacggaatgacaaactgttaaaaaaggctcgcatacacccgttccat
gttttgatcgcgttagagacttatagagcaggtcacgggctccgaggaaagctgaagtgg
tgtcctgatgaggaaattttgaaagctttggatgccgctttttacaaaacatttaagaca
gttgagccaactcgaaagcgttttgtgctggctgtggatgtcagtgcttctatggaccaa
cgagttttgggcagtgtcctcaatgccagcacagtcgccgcagcgatgtgcatggttgtc
gcacgaacagaaaaagattctcacatagttgcgttttctgatgaaatggtacgatgtcca
gtaactagagatatgactttacaacaggttttaatggctatgaatcagatcccagcaggt
ggaactgattgctctcttccgatgatctgggctcagaagacaaacaccgctgctgatgtc
ttcattgtgttcacagacaacgagacctttgctgggggtgtccaccctgccattgctctg
aggcagtatcgaaagaaaatgagcgtcccagctaaattgattgtctgtggaatgacatcg
agtggcttcaccattgcagacccagatgacagaggcatgttggatgtgtgtggctttgac
actggagctctggatgtaattcgaaatttcacattggatgtgatctaa

DBGET integrated database retrieval system