KEGG   Miniopterus natalensis (Natal long-fingered bat): 107538947
Entry
107538947         CDS       T05883                                 
Symbol
YOD1
Name
(RefSeq) ubiquitin thioesterase OTU1
  KO
K13719  ubiquitin thioesterase OTU1 [EC:3.1.2.-]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107538947 (YOD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107538947 (YOD1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-
     107538947 (YOD1)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C88
   107538947 (YOD1)
SSDB
Motif
Pfam: OTU Ubiquitin_2 zf-C2H2_2
Other DBs
NCBI-GeneID: 107538947
NCBI-ProteinID: XP_016070790
LinkDB
Position
Unknown
AA seq 348 aa
MFGPAKGGHFGVPSAAGGPGGVCHPAAGTKAGPAGAWQMGGRTDTMWRLRCKAKDGTYVL
QELSSRTRVRELQGQIAAITGIAPGCQRILVGYPPECLDLSDGDTMLGDLPIQSGDMLIV
EEDQTRPRTSPAFTRHGAPSNARETLPVLTRTSVPADNSCLFTSVYYVVEGGVLNPACAP
EMRRLIARIVASDPDFYSEAILGKTNQEYCEWIKRDDTWGGAIEISILSKFYQCEICVVD
TQTVRIDRFGEDAGYTKRVLLIYDGVHYDPLQRDFPDPDTPPLTIFSSNDDIVLVQALEL
ADEARRKRQFTDVNHFTLRCMICQKGLTGQAEAREHAKETGHTNFGEV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtttggcccggcgaaaggtggccattttggagtcccctcggcggcgggtggccccggc
ggcgtctgccatcctgctgccgggaccaaggctggccccgcgggcgcctggcaaatgggt
ggccggaccgacacgatgtggcggctccgctgcaaagccaaggatggcacctatgttttg
caggagttgtccagccggacccgggtgcgggaactccagggccaaattgctgccatcacg
gggatcgcccccggctgtcagcgcatcctcgtcggatacccgcccgagtgcctggatctc
agcgatggcgacaccatgctgggggatttgcccatccagtcgggcgacatgctgatcgtt
gaagaagaccaaaccaggccccgcacttcacctgcgtttaccagacatggtgctcctagt
aatgccagggaaactttgcctgtgcttaccagaacctccgtcccagcggacaactcttgc
ctctttaccagtgtgtactatgttgttgaaggaggagtcttgaatccagcttgcgcccct
gagatgagacgcctcatagcacgaattgtagcaagtgatccagatttctatagcgaagca
atactggggaaaacaaatcaggagtactgtgaatggatcaaaagggatgacacttgggga
ggagctattgaaatatcaattttgtccaaattttatcaatgtgagatatgtgtagtggat
acacagacagtaagaattgatcgttttggggaagatgcagggtataccaaaagggtcctg
cttatttatgatggcgtccactatgatccgcttcagcgtgactttcctgacccagacacc
cctcctctgaccattttctcctctaacgatgatattgttcttgtgcaagcactagaatta
gcagacgaagccagaagaaagagacagtttactgatgtaaaccacttcaccctgagatgc
atgatatgtcagaagggattaactggacaagcagaagcaagagaacatgccaaggagaca
ggccataccaactttggagaagtgtga

DBGET integrated database retrieval system