KEGG   Miniopterus natalensis (Natal long-fingered bat): 107538950
Entry
107538950         CDS       T05883                                 
Name
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03040  Spliceosome
mna04010  MAPK signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04144  Endocytosis
mna04213  Longevity regulating pathway - multiple species
mna04612  Antigen processing and presentation
mna04915  Estrogen signaling pathway
mna05020  Prion disease
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05162  Measles
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107538950
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107538950
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107538950
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107538950
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107538950
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107538950
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107538950
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    107538950
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107538950
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107538950
  09164 Neurodegenerative disease
   05020 Prion disease
    107538950
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107538950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107538950
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mna03041]
    107538950
   03009 Ribosome biogenesis [BR:mna03009]
    107538950
   03110 Chaperones and folding catalysts [BR:mna03110]
    107538950
   04131 Membrane trafficking [BR:mna04131]
    107538950
   03051 Proteasome [BR:mna03051]
    107538950
   03029 Mitochondrial biogenesis [BR:mna03029]
    107538950
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538950
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107538950
Spliceosome [BR:mna03041]
 Complex B
  Other components
   Prp19 complex
    107538950
 Complex C
   Prp19-CDC5 complex
    107538950
Ribosome biogenesis [BR:mna03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107538950
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP70 / DNAK
   107538950
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107538950
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107538950
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107538950
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107538950
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107538950
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Radial_spoke_3 FAD-SLDH Pox_D5 Hydantoinase_A
Other DBs
NCBI-GeneID: 107538950
NCBI-ProteinID: XP_016070789
LinkDB
Position
Unknown
AA seq 633 aa
MAKTTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDSVVQSDMKHWPFQVISDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYAVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLRGKLSEADKKKVLDKCQEVISWLDSNTLAEKEEFEHKRKELE
QVCNPIISGLYQGAGGPGAGKALKMLTYWLQQQ
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggctaaaaccacggccatcggcatcgacctgggcaccacctactcgtgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcaccgacaccgagcggctcatcggcgacgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgccaagcggctgatcggccgcaagttcggcgac
tcggtggtgcagtcggacatgaagcactggcctttccaggtgatcagtgacggggacaag
cccaaggtgcaggtgagctacaaaggggagaccaaggcgttctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacgcggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggac
gcgggggtgatcgcggggctgaacgtgctgaggatcatcaacgagcccacggcggccgcc
atcgcctacggcctggacaggacgggcaagggggagcgcaacgtgctcatcttcgacctg
ggcgggggcaccttcgacgtgtccatcctgaccatcgacgacggcatcttcgaggtgaag
gccacggcgggggacacccacctgggaggggaggactttgacaacaggctggtgagccac
ttcgtggaggagttcaagcgcaagcacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcaccagggcg
cggttcgaggagctgtgctccgacctgttccggggcaccctggagcccgtggagaaggcc
ctgcgcgacgccaagctggacaaggcccagatccacgacctggtcctggtggggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctcaac
aagagcatcaaccccgacgaggcggtggcctacggggcggcggtgcaggcagccatcctg
atgggggacaagtctgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcc
ttggggctggagacggccgggggcgtgatgacggctctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctattcggacaaccagccgggggtgctgatc
caggtgtacgagggcgagagggccatgacgagggacaacaacctgctggggcgcttcgag
ctgagcggcatccccccggccccccgaggcgtgccgcagatcgaggtgacctttgacatc
gacgccaatggcatcctgaacgtcacagccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagaggtacaaggcggaggacgaggtgcagcgcgagagggtgtcggccaagaac
gcgctggagtcgtacgccttcaacatgaagagcgccgtggaggacgaggggctgcggggc
aagctcagcgaggccgacaagaagaaggtgctggacaagtgccaggaggtcatttcctgg
ctggactccaacaccctggcggagaaggaggagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggggcgggcggcccgggggctgga
aaggccttgaaaatgttgacctactggctgcagcagcaatga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107539014
Entry
107539014         CDS       T05883                                 
Name
(RefSeq) LOW QUALITY PROTEIN: heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03040  Spliceosome
mna04010  MAPK signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04144  Endocytosis
mna04213  Longevity regulating pathway - multiple species
mna04612  Antigen processing and presentation
mna04915  Estrogen signaling pathway
mna05020  Prion disease
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05162  Measles
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107539014
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107539014
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107539014
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107539014
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107539014
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107539014
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107539014
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    107539014
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107539014
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107539014
  09164 Neurodegenerative disease
   05020 Prion disease
    107539014
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107539014
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107539014
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mna03041]
    107539014
   03009 Ribosome biogenesis [BR:mna03009]
    107539014
   03110 Chaperones and folding catalysts [BR:mna03110]
    107539014
   04131 Membrane trafficking [BR:mna04131]
    107539014
   03051 Proteasome [BR:mna03051]
    107539014
   03029 Mitochondrial biogenesis [BR:mna03029]
    107539014
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539014
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107539014
Spliceosome [BR:mna03041]
 Complex B
  Other components
   Prp19 complex
    107539014
 Complex C
   Prp19-CDC5 complex
    107539014
Ribosome biogenesis [BR:mna03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107539014
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP70 / DNAK
   107539014
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107539014
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107539014
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107539014
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107539014
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107539014
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Other DBs
NCBI-GeneID: 107539014
NCBI-ProteinID: XP_016070871
LinkDB
Position
Unknown
AA seq 639 aa
MAAAKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVTNEGGKPKVLVSYKGEQKAFYPEE
ISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKAGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLXDLSGIPPAPRGVPQIEVTFDI
DANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKN
ALESYAFNMKSAVSDEGLKGKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELE
QVCNPVITKLYQGGCTGPSCGTGYIPGRAATGPTIEEVD
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggctgctgctaagggaatggccatcggcatcgacctgggcaccacctactcgtgcgtg
ggggtgttccagcacggcaaggtggagatcattgccaacgaccagggcaaccgcaccacc
cccagctacgtggctttcaccgacactgagaggctcattggggatgcagccaagaaccag
gtagccatgaatcctcagaacactgtctttgatgccaaacgtctgattggcagaaaattt
aatgatcctgtagtgcaatcagatatgaaactttggccttttcaagtaaccaatgaagga
ggcaagcccaaggtattggtatcctacaaaggggagcaaaaagctttctatccagaggaa
atctcctctatggtgctgactaagatgaaggagactgctgaggcttttttgggccaccct
gtcaccaatgctgtgatcactgtgccagcatatttcaatgattctcaacggcaggctacc
aaggatgcaggcgtgattgcaggtctcaatgtactaagaattatcaatgaaccaacagct
gctgccattgcctatggcttagataaagcaggtcagggagagcgacatgtcctgatcttt
gatctgggtggaggcacatttgatgtgtccatcctgaccatagatgatgggatttttgag
gtgaaggccacagccggggacacccacctgggaggggaggactttgacaacaggctggtg
agccacttcgtggaggagttcaagcgcaagcacaagaaggacatcagccagaacaagcga
gccgtgaggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacc
caggccaacttggaaattgattcactttatgaaggcattgacttctacacgtccattact
agagcccggtttgaagagctgtgtgcagacctctttaggggcactctggagcccgtggag
aaggccctgcgcgacgccaagatggacaaggctaaaatccatgacattgttttggtgggg
ggttccacccgcatccccaaggtgcagaaactgctacaggactactttaatggccgtgat
ctcaacaagagcatcaaccccgacgaggcagtggcctacggggcggcggtgcaggcagcc
atcctgatgggggacaagtctgagaacgtgcaggacctgctgctgctggacgtggctccc
ctgtccttggggctggagacggccgggggcgtgatgacggccctgatcaagcgcaactcc
accatccccaccaagcagacgcagatcttcaccacctattcggacaaccagccgggggtg
ctgatccaggtgtacgagggcgagagggccatgacgagggacaacaacctgctnnntgac
ctgagtggaatccctcctgcacccagaggagttcctcagatcgaagtgacttttgatatt
gatgccaacggtattcttaatgtaacagccatggacaagagcactggcaaagccaacaag
atcaccatcaccaatgacaagggccgcctgagcaaggaggagatcgagcgcatggttctg
gatgccgagaaatataaagctgaagatgaagtccagagagagaaaattgctgcaaaaaat
gccttagaatcctatgcttttaacatgaagagtgctgtgagtgatgaaggcttgaagggt
aagattagtgagtctgataaaaagaaaatactggataaatgcaatgaggtcctttcatgg
ctggaggccaatcaactagctgaaaaagatgagtttgatcataagagaaaggaactggag
caagtgtgtaacccagtaatcacaaaactctaccagggaggatgcactgggccttcctgt
ggaacagggtacatacctggaagggctgccacaggccccaccattgaagaagtagattaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107540605
Entry
107540605         CDS       T05883                                 
Symbol
HSPA8
Name
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03040  Spliceosome
mna04010  MAPK signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04144  Endocytosis
mna04213  Longevity regulating pathway - multiple species
mna04612  Antigen processing and presentation
mna04915  Estrogen signaling pathway
mna05020  Prion disease
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05162  Measles
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107540605 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107540605 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107540605 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107540605 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107540605 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107540605 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107540605 (HSPA8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    107540605 (HSPA8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107540605 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107540605 (HSPA8)
  09164 Neurodegenerative disease
   05020 Prion disease
    107540605 (HSPA8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107540605 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107540605 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mna03041]
    107540605 (HSPA8)
   03009 Ribosome biogenesis [BR:mna03009]
    107540605 (HSPA8)
   03110 Chaperones and folding catalysts [BR:mna03110]
    107540605 (HSPA8)
   04131 Membrane trafficking [BR:mna04131]
    107540605 (HSPA8)
   03051 Proteasome [BR:mna03051]
    107540605 (HSPA8)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107540605 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107540605 (HSPA8)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107540605 (HSPA8)
Spliceosome [BR:mna03041]
 Complex B
  Other components
   Prp19 complex
    107540605 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    107540605 (HSPA8)
Ribosome biogenesis [BR:mna03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107540605 (HSPA8)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP70 / DNAK
   107540605 (HSPA8)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107540605 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107540605 (HSPA8)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107540605 (HSPA8)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107540605 (HSPA8)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107540605 (HSPA8)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA Radial_spoke_3
Other DBs
NCBI-GeneID: 107540605
NCBI-ProteinID: XP_016072884
LinkDB
Position
Unknown
AA seq 646 aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDDDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtctaagggacctgcagtcggcattgatcttggcaccacctactcttgtgtgggtgtc
ttccagcatggaaaagtggaaataattgccaacgatcagggcaaccgaactactccaagt
tatgttgcctttactgataccgaacgattgatcggtgatgctgcaaagaatcaagttgca
atgaatcctaccaacacggtttttgatgccaagcgcttgattggacgtagatttgatgat
gccgttgtccaatctgatatgaagcattggcccttcatggtggtgaatgatgctggcagg
cccaaggtccaagtagaatacaagggagagaccaaaagtttctatccagaagaggtgtcg
tctatggttttgacaaagatgaaggaaatcgcagaagcctaccttgggaagactgttacc
aatgctgttgtcacagtacctgcatatttcaatgactctcagcgtcaggctaccaaagat
gctggaactattgctggtctcaatgtacttagaatcatcaatgagccaactgctgctgct
attgcttatggcttagacaaaaaggttggagctgaaagaaatgtgctgatctttgacttg
ggaggtggcacttttgatgtgtcaatcctcacaattgaagatggaatctttgaggtcaaa
tctacagctggggacacccacttaggtggagaagattttgacaacagaatggtcaaccat
ttcattgcagagttcaagcgcaagcataagaaggacatcagtgagaacaagagggctgtc
cggcgccttcgtactgcttgtgaacgtgctaagcgtactctctcttccagtacccaggcc
agtattgagattgattcgctctatgaaggaatcgacttctatacctctatcacccgtgcc
cgatttgaagaattgaatgctgaccttttccgtggcaccctggaccctgtagagaaagct
cttcgggatgccaagcttgacaagtcccagatccatgatattgtcctggtgggtggttct
actcgtatccccaagattcagaaactcctgcaggacttcttcaatggcaaagagttgaat
aagagcatcaaccctgacgaggctgttgcttacggtgcagctgtccaggcagccattctt
tctggagacaaatctgaaaatgttcaagatttgctgctgttggatgtcactcctctttcc
cttgggattgagactgctggtggagtcatgactgtcctcatcaagcgcaatactaccatt
cctaccaagcagacacagaccttcactacctactctgacaatcagcctggtgtgctcatt
caggtttatgaaggtgagcgtgccatgaccaaggataacaacctgcttggcaagtttgaa
ctcacaggcatacctcctgcacctcgtggtgttcctcagattgaagtcacttttgatatt
gatgccaacggcatcctcaatgtctctgctgtggataagagcacaggaaaagagaacaag
atcaccatcactaacgacaagggtcgtctgagcaaggaggacattgagcgcatggtccag
gaagctgagaagtacaaagctgaagatgagaagcagcgggacaaggtgtcctcaaagaat
tcccttgagtcctatgcgttcaacatgaaagcaactgttgaagatgaaaaacttcaaggc
aagatcaatgatgatgacaaacagaagattcttgacaagtgcaatgaaatcatcaactgg
cttgataagaaccagactgcagaaaaagaagagtttgaacatcagcagaaagagttggaa
aaagtctgcaaccccatcattaccaagctgtaccagagcgcaggaggcatgccaggagga
atgcctggaggcttccctggtggtggagctcctccatctggtggtgcgtcctctgggccc
accattgaagaggttgattaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545657
Entry
107545657         CDS       T05883                                 
Symbol
HSPA2
Name
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03040  Spliceosome
mna04010  MAPK signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04144  Endocytosis
mna04213  Longevity regulating pathway - multiple species
mna04612  Antigen processing and presentation
mna04915  Estrogen signaling pathway
mna05020  Prion disease
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05162  Measles
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107545657 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545657 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545657 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107545657 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107545657 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107545657 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107545657 (HSPA2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    107545657 (HSPA2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107545657 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545657 (HSPA2)
  09164 Neurodegenerative disease
   05020 Prion disease
    107545657 (HSPA2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107545657 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107545657 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mna03041]
    107545657 (HSPA2)
   03009 Ribosome biogenesis [BR:mna03009]
    107545657 (HSPA2)
   03110 Chaperones and folding catalysts [BR:mna03110]
    107545657 (HSPA2)
   04131 Membrane trafficking [BR:mna04131]
    107545657 (HSPA2)
   03051 Proteasome [BR:mna03051]
    107545657 (HSPA2)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107545657 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545657 (HSPA2)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107545657 (HSPA2)
Spliceosome [BR:mna03041]
 Complex B
  Other components
   Prp19 complex
    107545657 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    107545657 (HSPA2)
Ribosome biogenesis [BR:mna03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107545657 (HSPA2)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP70 / DNAK
   107545657 (HSPA2)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107545657 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107545657 (HSPA2)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107545657 (HSPA2)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107545657 (HSPA2)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107545657 (HSPA2)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF1464 CRIC_ras_sig
Other DBs
NCBI-GeneID: 107545657
NCBI-ProteinID: XP_016079267
LinkDB
Position
Unknown
AA seq 635 aa
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEIKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYAYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGSGASGGPTIEEVD
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtctgcccgcggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggg
gtcttccagcatggcaaggtggagatcatcgccaacgaccagggcaaccgcaccaccccc
agctacgtggccttcaccgacaccgagcgcctcattggcgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccattttcgacgccaagaggctgatcggacgtaagttcgag
gacgccacagtgcagtcggacatgaaacactggccgttccgggtggtgagcgagggaggg
aagcccaaagtgcaggtggaatacaagggagagatcaagaccttcttcccggaggagatc
tcctccatggtcctcacgaagatgaaggagatcgccgaagcctacctgggaggcaaggtg
cagagcgcggtcattaccgtccccgcctatttcaacgactcgcagcgccaggccaccaag
gacgcgggcaccatcacgggcctcaacgtgctccgcatcatcaacgagcccacggcggca
gccatcgcctacggcctggacaagaagggctgcgcgggcggcgagaagaacgtgctcatt
tttgacctgggcggcggcacctttgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtccacggccggcgacacccacttgggcggtgaggactttgacaaccggatg
gtgagccacctggcggaagagttcaaacgcaagcacaagaaggacatcgggcccaacaag
cgcgcggtgcggcggcttcgcaccgcctgcgagcgcgccaagcgcaccctgagctcgtcc
acgcaggccagcatcgagatcgactcgctctacgagggtgtggacttctacacgtccatc
acccgcgcccgcttcgaggagctgaacgccgacctcttccgcggcaccctggagcccgtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagatcgtgctggtt
ggcggctccacccgcatccccaagatccagaagctgctgcaggatttcttcaacggcaaa
gagctgaacaaaagcatcaaccccgacgaggcggtggcctacggagccgcggtgcaggcg
gccatcctcatcggagacaagtcagagaacgtgcaggacctgctgctactcgacgtgacc
ccgttgtcgctgggcatcgagacggccggcggcgtcatgaccccgctcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcagacaaccagagcagc
gtgctggtgcaggtgtacgagggcgaacgggccatgaccaaggacaataacctgctgggc
aagttcgacctaaccgggattcccccggcgccccgcggggtcccccagatcgaggttacc
ttcgacatcgacgccaacggcatcctcaatgtcaccgccgccgacaagagcacgggtaaa
gaaaacaaaatcaccatcaccaacgacaagggtcgtctgagcaaggacgacattgaccgg
atggtgcaggaggcggagcgatacaagtccgaagatgaagccaatcgcgaccgcgtcgcc
gccaaaaacgcggtggagtcctacgcctacaacatcaagcagacagtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctcgaccgaaaccagatggccgagaaagatgagtatgaacacaagcagaaa
gagctggagagagtgtgcaaccccatcatcagcaaactttaccaaggcggccctggcggc
ggcgggtctggagcctccgggggacccaccatcgaggaagtggactaa

DBGET integrated database retrieval system