KEGG   Miniopterus natalensis (Natal long-fingered bat): 107538990
Entry
107538990         CDS       T05883                                 
Name
(RefSeq) complement C4-B-like isoform X1
  KO
K03989  complement component 4
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04610  Complement and coagulation cascades
mna04936  Alcoholic liver disease
mna05133  Pertussis
mna05150  Staphylococcus aureus infection
mna05171  Coronavirus disease - COVID-19
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107538990
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107538990
  09171 Infectious disease: bacterial
   05133 Pertussis
    107538990
   05150 Staphylococcus aureus infection
    107538990
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107538990
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    107538990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107538990
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538990
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   107538990
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107538990
  Exosomal proteins of other cancer cells
   107538990
SSDB
Motif
Pfam: TED_complement A2M_BRD A2M_recep A2M NTR MG2 MG3 ANATO MG4 Big_1 SQHop_cyclase_C Prenyltrans
Other DBs
NCBI-GeneID: 107538990
NCBI-ProteinID: XP_016070836
LinkDB
Position
Unknown
AA seq 1755 aa
MRLLWGLMWASSFFALSLQKPRLLLFSPSVVHLGAPLSVGLQLQDAPRGQEVKGSVFLRN
PYHLQVSCSSKVDFLLTSEKDFILLSLQILPKDAERCGLKSLLGGPQVQLVAKSPWLKST
LSKEVDIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDSLTVTVEN
SHGLRVRKRQVYAPSSIFQDDFVIPDISEPGTWKISARFSDGLESNRSTQFEVKKYVLPN
FEVKIIPGEPYILTAPGILGDIQLDIQARYIYGKPVQGVAYVRFGLLDENGDKTFLRGLE
TQTKLAEGQCHISLSEAEVQGALEKLSIHLPDLPGLRLYVAAAVIESPGGEMEEAELTSW
RFVSSPFSLDLSHTKRHLVPGAPFLLQALVRDMSGSPAPGIPVKVAATFSPVSASEVRDF
QQNTDGSGQAVVPIVVPQAASEVQLLVSAGSPHPATAKLTVRAPRSGSSGFLSIERLDPQ
PPRVGDTFSLNLRAVGVSEASFSHYYYLILSRGQIMSVGREPRSALTSVSVFVNHHLAPS
FYFVAFYYHGGVPVANSLRVFVQAGTCEGKLELSVDSHKDYRPGETVKLQLRTDSLAQVA
LGAVDTALYAVGGRSHKPLDMGKVFEVMNSYDLSCGPGGGDSALQVFEAAGLAFSDGNQW
TSVRKILLSPGLSCPKEKKTRRKRSVNFQKAVNEKLGQYTSPVAKRCCQDGLTRLPMILS
CEQRAARVPQLACREPFLSCCQFAEGLRKKTRVRGQVGLARALEILQEEDLIDEDDIPVR
SFFPENWLWRVDLVDHFLQLPLMLPDSLTTWEIHGVSLSKTTGLCVATPVRLRVFREFHL
HLRLPISVRRFEQLELRPVLYNYLDKNLTMSVHVSPVDGLCLAGGGGLAQQVLVPAHSAR
PVAFSVVPTAAAAVSLKVVARGSLEFPVGDAVSKILQIEKEGAIHMEEMVYELNPLDHRG
RTLEIPGSSDPNIIPDGDHNSLVRVTASEPLDTLGSGGALSPGGVASLLRLPVGCGEQTM
TILSPTLAASQYLDKTEQWSKLPPETKDHAVDLIQKGYMRIQQFRKSDGSYGAWLHRESS
TWLTAFVLKVLSLAQEQVGDSPEKLQETATWLLSQQQADGSFQDSCPVIHRGMQGGLVGN
DETVALTAFVVIALHHGLAVFQDESAAQLKRRVETSISKANSFLGPKASAGLLGAHAAAI
TAYALTLTKAPEDLRDVAHNNLMAMAQETGDSLYWGSVITSQSNVVSPTPAPRSPTDPVP
QAPAVWIETTAYGLLHLLLREGRAEMADQAAAWLTRQGSFRGGFRSTQDTVIGLDALSAY
WIASHTTEGRELNVTLSSMGRSGFKSHVLHLNSHQVPGVEEELQFYVSSKINVKVGGNSK
GTLKVLRTYNVLDMKNTTCQDLQIEVTVMGHVEYTMAASEDYEEDYGDEEYSESLGPAGD
DPGALSQPVTPLQVFEGRRSRRRREAPKVADEQESRVQYTVCIWRNGKVGLSGMAIADIT
LLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFGAVQEVAVGLV
QPASAALYDYYNPERKCSVFYGAPTKSKLLSTLCSADVCQCAEGKCPRQRRALERGQMEE
DGYRMRFACYYPRVDYGFQVKVLREDSRAAFRLFETSVTQVLHFSKDTKATAGQTRNFLV
RASCRLRLEPGKEYLIMGLDGATHDLNGQPQYLLDSNSWIEEMPSERLCRSTRQRAACAQ
LRSFLQEYGTQGCQV
NT seq 5268 nt   +upstreamnt  +downstreamnt
atgaggctcctctgggggctgatgtgggcatccagcttctttgccttgtctctgcagaaa
cccaggttgctcctgttttctccttccgtggttcacctgggggcccccctgtcagtgggg
ctgcagctccaggatgctccccggggacaggaagtgaaaggatcagtgttcctgagaaac
ccgtaccatcttcaggtctcctgctcctcaaaggtggacttcctcctcacctcggaaaaa
gacttcattctcctcagcctccagatactcccgaaagatgctgagcgctgtggcctcaaa
agcctccttggaggcccccaggtccagctggtggccaagtcaccatggctgaagagcacg
ctgtccaaggaagtagacattcagggcatcaacctgctcttttcctctcgccggggacac
ctttttctgcagaccgaccagcccatttataaccctggccagcgggtacggtaccgggtc
tttgctctggatcaaaagatgcgcccatccacggacagccttacggtcactgtggagaac
tctcacggcctccgtgtgcggaagaggcaggtgtacgctccctcatccatcttccaggat
gactttgtgatcccggacatctcagagccagggacttggaagatctcagctagattctca
gatggcctagaatccaacagaagcacccagttcgaggtgaagaaatatgtccttcccaac
tttgaagtaaagatcatccctggagagccctacatcctgacagcacctggcattcttggt
gacatccagttagacatccaggccaggtacatctatgggaagccagtgcaaggggtggcg
tatgtgcgctttgggctcctggatgagaatggtgacaagactttccttcgggggctggag
actcagaccaagctggccgagggccagtgccacatctccctctcagaggctgaggttcag
ggcgccctggagaagcttagcatccacctgcctgacctcccagggctgcgcctctatgtg
gcagctgccgtcattgaatctccagggggagagatggaggaggcagagctcacatcctgg
cgttttgtgtcatctcccttctccttggatctgagccacaccaagcgacacctcgtgcct
ggggccccctttctgctgcaggccctggtccgagacatgtcaggctccccagcccctggc
attcctgtcaaagttgctgccacgttctctcctgtgtctgcttctgaagtgcgtgacttt
cagcagaacacagacgggagtggccaagctgttgttcccattgtcgtacctcaggccgcc
tcggaagtgcagctcttggtgtctgcaggctccccccatccagccacagccaagctcact
gtgagagccccacgctcaggaagctccgggtttctgtccattgaacggctggatcctcaa
ccccctcgagttggggacacttttagcctgaacctgcgggccgtgggcgtcagtgaggcc
agcttctctcactactactacctgatcctgtcccggggccagatcatgtctgtgggccga
gagcccaggagcgccctgacctcggtttccgtgtttgtgaaccaccacctggcaccctcc
ttctactttgtggccttctactatcatgggggtgtcccagtggccaactccctgcgagtg
ttcgtccaggccgggacctgtgagggcaagctggagctgagtgtggacagccacaaggac
taccgccctggggagacagtgaagctccagctgcgcacagattctctggcccaggtggcc
ctgggagctgtggacaccgctctgtatgccgtgggtggcaggtcccacaagcccctggac
atgggcaaggtcttcgaagtcatgaacagctatgacctcagctgtggtcctgggggcgga
gacagtgccctgcaggtgtttgaggcagctggtctggccttttctgatggaaaccagtgg
acctcagtcagaaagatcctgctctcaccaggtctgagttgtcccaaggagaagaaaacc
cggagaaagcgaagtgtgaacttccagaaggcagttaatgagaagttgggccagtacact
tccccagtagccaagcgttgctgccaggatgggctgacgcggctgcccatgatcctctcc
tgtgagcagcgagcggcccgtgtgccgcagctggcctgccgggagcccttcctgtcctgc
tgccagttcgctgagggcctgcgcaagaagacccgggtcaggggccaggttggccttgcc
cgagctctggagatcctgcaggaggaggacctgatagacgaagacgacattcctgtgcgc
agcttcttcccggagaactggctctggagagtggacctcgtggaccacttcctccaattg
ccattgatgcttcctgactctctgaccacatgggagatccatggcgtgagcctgtccaaa
acaacaggcctgtgtgtggccacaccagtgcggctccgggtgttccgggaatttcacctg
cacctccgcctgcccatctctgttcgccgctttgagcagcttgagctacggcctgtcctc
tacaactacctggataagaacctgactatgagcgtccacgtctccccagtagatgggctg
tgcctggctgggggtggagggctggcccagcaggtgctggtgcctgcacactccgccagg
cctgttgccttctctgtggtgcccacggcggccgctgctgtgtccctgaaggtggtggct
cgagggtccttggagttccctgtaggggatgcagtgtctaagattctacaaatcgagaag
gaaggggccatccacatggaggagatggtctatgaactcaaccccctggaccaccgaggc
cggaccttggaaattcctggcagctctgatcccaatattatccctgatggagatcacaac
agccttgtcagggtcacagcctcagagccactggacactttgggctctgggggggccttg
tcaccaggaggtgtggcctccctcctgaggcttccggtgggctgcggggaacaaaccatg
accatcttgtccccaacactggccgcttcccaatacctggacaagacagagcaatggagc
aaactgcccccagagaccaaggaccacgctgtggatctgatccagaaaggctacatgcgg
atacagcagttccggaaatcagatggctcctatggggcatggctacatcgggaaagtagc
acctggctcacagcgtttgtgctgaaggtactgagtttggcccaggaacaggtgggcgac
tcacctgaaaagctgcaggagacagccacctggctgctgtctcagcagcaggccgatggt
tcattccaggactcctgtccagttatccacaggggcatgcaggggggcttggtaggaaat
gacgagaccgtggccctgactgcctttgtggtcatcgcccttcaccatgggctggccgtc
ttccaggatgagagtgcagcgcagctgaagcggagagtggaaacttccatctcaaaagca
aactcatttttggggccaaaagcaagtgctgggctcctgggtgcccatgcagccgccatc
acggcctacgctctgacactgaccaaggcccctgaggacctgcgggatgtggcccacaac
aacctcatggccatggcccaagagacaggcgatagcctgtactggggctcggtcatcact
tctcagagcaatgtcgtgtcgcccaccccggctccgcgcagccccacagaccctgtgccc
caggccccggccgtgtggattgaaactacagcctacggcctgctgcacctgctactccgg
gagggcagggcagagatggctgaccaggctgcagcctggctcacccgccagggcagcttc
cgagggggattccgcagcacccaggacacggtgattggcctggatgcactgtctgcatac
tggatcgcttcccacaccactgaggggagggagctcaacgtgaccctcagctccatgggc
cgcagtgggttcaagtcccacgtgctgcatctgaacagccaccaggttccaggggtagag
gaggagctgcagttttacgtgagcagcaagattaacgtgaaggtgggaggaaacagcaaa
ggaactttgaaggtccttcgcacctacaatgtcctggacatgaagaacacgacctgccag
gatcttcagattgaggtgacggtcatgggccatgttgagtacacaatggcagccagcgag
gactacgaggaggactatggggatgaggagtactccgagagcctgggtcccgctggcgac
gacccgggggccctttcccagcccgtgacacccctgcaggtgtttgaggggcggaggagc
cgccgcagacgggaggcacccaaggtggccgatgagcaggagtccagggtgcagtacacc
gtgtgcatctggcggaacggcaaggtggggctgtcaggcatggccattgcggacatcacc
ctcctgagtggtttccacgccctgcgagctgacctggaaaagctgacttccctctctgac
cgttatgtgagtcactttgagaccgaggggccccacgtcctgctgtacttcgactcggtc
cccacctctcgggagtgcgtgggctttggagctgtgcaggaggtggccgtggggctggtt
cagccggccagcgcggccctgtacgactactacaaccctgagcgcaagtgttctgtgttt
tacggagcaccgactaagagcaaactcttgtccacattgtgctccgctgatgtctgccag
tgtgccgaggggaagtgcccgaggcagcggcgcgccctggagcgcgggcagatggaggag
gatggctaccggatgcggttcgcctgctactacccccgagtggactacggcttccaggtg
aaggttctcagagaagattccagagctgctttccgcctcttcgagaccagtgtcacccaa
gtcctgcacttctccaaagacaccaaagccactgctggtcagacccgaaactttctggtt
cgagcctcttgccgccttcgcttggaacctggaaaagaatatttgatcatgggtctggat
ggggccacccatgacctcaacggacaaccccagtacctgctggactcgaacagctggatt
gaggagatgccctctgaacgcttgtgccggagcacccgccagcgggcagcctgtgcccag
ctccgcagcttcctgcaggagtatggcacccaggggtgccaggtttga

DBGET integrated database retrieval system