KEGG   Miniopterus natalensis: 107538990
Entry
107538990         CDS       T05883                                 

Definition
(RefSeq) complement C4-B-like isoform X1
  KO
K03989  complement component 4
Organism
mna  Miniopterus natalensis
Pathway
mna04610  Complement and coagulation cascades
mna05133  Pertussis
mna05150  Staphylococcus aureus infection
mna05171  Coronavirus disease - COVID-19
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107538990
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107538990
  09171 Infectious disease: bacterial
   05133 Pertussis
    107538990
   05150 Staphylococcus aureus infection
    107538990
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107538990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107538990
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538990
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   107538990
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107538990
  Exosomal proteins of other cancer cells
   107538990
SSDB
Motif
Pfam: TED_complement A2M_BRD A2M_recep A2M NTR MG2 MG3 ANATO MG4 Big_1 SQHop_cyclase_C Prenyltrans
Other DBs
NCBI-GeneID: 107538990
NCBI-ProteinID: XP_016070836
LinkDB
Position
Unknown
AA seq 1755 aa
MRLLWGLMWASSFFALSLQKPRLLLFSPSVVHLGAPLSVGLQLQDAPRGQEVKGSVFLRN
PYHLQVSCSSKVDFLLTSEKDFILLSLQILPKDAERCGLKSLLGGPQVQLVAKSPWLKST
LSKEVDIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDSLTVTVEN
SHGLRVRKRQVYAPSSIFQDDFVIPDISEPGTWKISARFSDGLESNRSTQFEVKKYVLPN
FEVKIIPGEPYILTAPGILGDIQLDIQARYIYGKPVQGVAYVRFGLLDENGDKTFLRGLE
TQTKLAEGQCHISLSEAEVQGALEKLSIHLPDLPGLRLYVAAAVIESPGGEMEEAELTSW
RFVSSPFSLDLSHTKRHLVPGAPFLLQALVRDMSGSPAPGIPVKVAATFSPVSASEVRDF
QQNTDGSGQAVVPIVVPQAASEVQLLVSAGSPHPATAKLTVRAPRSGSSGFLSIERLDPQ
PPRVGDTFSLNLRAVGVSEASFSHYYYLILSRGQIMSVGREPRSALTSVSVFVNHHLAPS
FYFVAFYYHGGVPVANSLRVFVQAGTCEGKLELSVDSHKDYRPGETVKLQLRTDSLAQVA
LGAVDTALYAVGGRSHKPLDMGKVFEVMNSYDLSCGPGGGDSALQVFEAAGLAFSDGNQW
TSVRKILLSPGLSCPKEKKTRRKRSVNFQKAVNEKLGQYTSPVAKRCCQDGLTRLPMILS
CEQRAARVPQLACREPFLSCCQFAEGLRKKTRVRGQVGLARALEILQEEDLIDEDDIPVR
SFFPENWLWRVDLVDHFLQLPLMLPDSLTTWEIHGVSLSKTTGLCVATPVRLRVFREFHL
HLRLPISVRRFEQLELRPVLYNYLDKNLTMSVHVSPVDGLCLAGGGGLAQQVLVPAHSAR
PVAFSVVPTAAAAVSLKVVARGSLEFPVGDAVSKILQIEKEGAIHMEEMVYELNPLDHRG
RTLEIPGSSDPNIIPDGDHNSLVRVTASEPLDTLGSGGALSPGGVASLLRLPVGCGEQTM
TILSPTLAASQYLDKTEQWSKLPPETKDHAVDLIQKGYMRIQQFRKSDGSYGAWLHRESS
TWLTAFVLKVLSLAQEQVGDSPEKLQETATWLLSQQQADGSFQDSCPVIHRGMQGGLVGN
DETVALTAFVVIALHHGLAVFQDESAAQLKRRVETSISKANSFLGPKASAGLLGAHAAAI
TAYALTLTKAPEDLRDVAHNNLMAMAQETGDSLYWGSVITSQSNVVSPTPAPRSPTDPVP
QAPAVWIETTAYGLLHLLLREGRAEMADQAAAWLTRQGSFRGGFRSTQDTVIGLDALSAY
WIASHTTEGRELNVTLSSMGRSGFKSHVLHLNSHQVPGVEEELQFYVSSKINVKVGGNSK
GTLKVLRTYNVLDMKNTTCQDLQIEVTVMGHVEYTMAASEDYEEDYGDEEYSESLGPAGD
DPGALSQPVTPLQVFEGRRSRRRREAPKVADEQESRVQYTVCIWRNGKVGLSGMAIADIT
LLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFGAVQEVAVGLV
QPASAALYDYYNPERKCSVFYGAPTKSKLLSTLCSADVCQCAEGKCPRQRRALERGQMEE
DGYRMRFACYYPRVDYGFQVKVLREDSRAAFRLFETSVTQVLHFSKDTKATAGQTRNFLV
RASCRLRLEPGKEYLIMGLDGATHDLNGQPQYLLDSNSWIEEMPSERLCRSTRQRAACAQ
LRSFLQEYGTQGCQV
NT seq 5268 nt   +upstreamnt  +downstreamnt
atgaggctcctctgggggctgatgtgggcatccagcttctttgccttgtctctgcagaaa
cccaggttgctcctgttttctccttccgtggttcacctgggggcccccctgtcagtgggg
ctgcagctccaggatgctccccggggacaggaagtgaaaggatcagtgttcctgagaaac
ccgtaccatcttcaggtctcctgctcctcaaaggtggacttcctcctcacctcggaaaaa
gacttcattctcctcagcctccagatactcccgaaagatgctgagcgctgtggcctcaaa
agcctccttggaggcccccaggtccagctggtggccaagtcaccatggctgaagagcacg
ctgtccaaggaagtagacattcagggcatcaacctgctcttttcctctcgccggggacac
ctttttctgcagaccgaccagcccatttataaccctggccagcgggtacggtaccgggtc
tttgctctggatcaaaagatgcgcccatccacggacagccttacggtcactgtggagaac
tctcacggcctccgtgtgcggaagaggcaggtgtacgctccctcatccatcttccaggat
gactttgtgatcccggacatctcagagccagggacttggaagatctcagctagattctca
gatggcctagaatccaacagaagcacccagttcgaggtgaagaaatatgtccttcccaac
tttgaagtaaagatcatccctggagagccctacatcctgacagcacctggcattcttggt
gacatccagttagacatccaggccaggtacatctatgggaagccagtgcaaggggtggcg
tatgtgcgctttgggctcctggatgagaatggtgacaagactttccttcgggggctggag
actcagaccaagctggccgagggccagtgccacatctccctctcagaggctgaggttcag
ggcgccctggagaagcttagcatccacctgcctgacctcccagggctgcgcctctatgtg
gcagctgccgtcattgaatctccagggggagagatggaggaggcagagctcacatcctgg
cgttttgtgtcatctcccttctccttggatctgagccacaccaagcgacacctcgtgcct
ggggccccctttctgctgcaggccctggtccgagacatgtcaggctccccagcccctggc
attcctgtcaaagttgctgccacgttctctcctgtgtctgcttctgaagtgcgtgacttt
cagcagaacacagacgggagtggccaagctgttgttcccattgtcgtacctcaggccgcc
tcggaagtgcagctcttggtgtctgcaggctccccccatccagccacagccaagctcact
gtgagagccccacgctcaggaagctccgggtttctgtccattgaacggctggatcctcaa
ccccctcgagttggggacacttttagcctgaacctgcgggccgtgggcgtcagtgaggcc
agcttctctcactactactacctgatcctgtcccggggccagatcatgtctgtgggccga
gagcccaggagcgccctgacctcggtttccgtgtttgtgaaccaccacctggcaccctcc
ttctactttgtggccttctactatcatgggggtgtcccagtggccaactccctgcgagtg
ttcgtccaggccgggacctgtgagggcaagctggagctgagtgtggacagccacaaggac
taccgccctggggagacagtgaagctccagctgcgcacagattctctggcccaggtggcc
ctgggagctgtggacaccgctctgtatgccgtgggtggcaggtcccacaagcccctggac
atgggcaaggtcttcgaagtcatgaacagctatgacctcagctgtggtcctgggggcgga
gacagtgccctgcaggtgtttgaggcagctggtctggccttttctgatggaaaccagtgg
acctcagtcagaaagatcctgctctcaccaggtctgagttgtcccaaggagaagaaaacc
cggagaaagcgaagtgtgaacttccagaaggcagttaatgagaagttgggccagtacact
tccccagtagccaagcgttgctgccaggatgggctgacgcggctgcccatgatcctctcc
tgtgagcagcgagcggcccgtgtgccgcagctggcctgccgggagcccttcctgtcctgc
tgccagttcgctgagggcctgcgcaagaagacccgggtcaggggccaggttggccttgcc
cgagctctggagatcctgcaggaggaggacctgatagacgaagacgacattcctgtgcgc
agcttcttcccggagaactggctctggagagtggacctcgtggaccacttcctccaattg
ccattgatgcttcctgactctctgaccacatgggagatccatggcgtgagcctgtccaaa
acaacaggcctgtgtgtggccacaccagtgcggctccgggtgttccgggaatttcacctg
cacctccgcctgcccatctctgttcgccgctttgagcagcttgagctacggcctgtcctc
tacaactacctggataagaacctgactatgagcgtccacgtctccccagtagatgggctg
tgcctggctgggggtggagggctggcccagcaggtgctggtgcctgcacactccgccagg
cctgttgccttctctgtggtgcccacggcggccgctgctgtgtccctgaaggtggtggct
cgagggtccttggagttccctgtaggggatgcagtgtctaagattctacaaatcgagaag
gaaggggccatccacatggaggagatggtctatgaactcaaccccctggaccaccgaggc
cggaccttggaaattcctggcagctctgatcccaatattatccctgatggagatcacaac
agccttgtcagggtcacagcctcagagccactggacactttgggctctgggggggccttg
tcaccaggaggtgtggcctccctcctgaggcttccggtgggctgcggggaacaaaccatg
accatcttgtccccaacactggccgcttcccaatacctggacaagacagagcaatggagc
aaactgcccccagagaccaaggaccacgctgtggatctgatccagaaaggctacatgcgg
atacagcagttccggaaatcagatggctcctatggggcatggctacatcgggaaagtagc
acctggctcacagcgtttgtgctgaaggtactgagtttggcccaggaacaggtgggcgac
tcacctgaaaagctgcaggagacagccacctggctgctgtctcagcagcaggccgatggt
tcattccaggactcctgtccagttatccacaggggcatgcaggggggcttggtaggaaat
gacgagaccgtggccctgactgcctttgtggtcatcgcccttcaccatgggctggccgtc
ttccaggatgagagtgcagcgcagctgaagcggagagtggaaacttccatctcaaaagca
aactcatttttggggccaaaagcaagtgctgggctcctgggtgcccatgcagccgccatc
acggcctacgctctgacactgaccaaggcccctgaggacctgcgggatgtggcccacaac
aacctcatggccatggcccaagagacaggcgatagcctgtactggggctcggtcatcact
tctcagagcaatgtcgtgtcgcccaccccggctccgcgcagccccacagaccctgtgccc
caggccccggccgtgtggattgaaactacagcctacggcctgctgcacctgctactccgg
gagggcagggcagagatggctgaccaggctgcagcctggctcacccgccagggcagcttc
cgagggggattccgcagcacccaggacacggtgattggcctggatgcactgtctgcatac
tggatcgcttcccacaccactgaggggagggagctcaacgtgaccctcagctccatgggc
cgcagtgggttcaagtcccacgtgctgcatctgaacagccaccaggttccaggggtagag
gaggagctgcagttttacgtgagcagcaagattaacgtgaaggtgggaggaaacagcaaa
ggaactttgaaggtccttcgcacctacaatgtcctggacatgaagaacacgacctgccag
gatcttcagattgaggtgacggtcatgggccatgttgagtacacaatggcagccagcgag
gactacgaggaggactatggggatgaggagtactccgagagcctgggtcccgctggcgac
gacccgggggccctttcccagcccgtgacacccctgcaggtgtttgaggggcggaggagc
cgccgcagacgggaggcacccaaggtggccgatgagcaggagtccagggtgcagtacacc
gtgtgcatctggcggaacggcaaggtggggctgtcaggcatggccattgcggacatcacc
ctcctgagtggtttccacgccctgcgagctgacctggaaaagctgacttccctctctgac
cgttatgtgagtcactttgagaccgaggggccccacgtcctgctgtacttcgactcggtc
cccacctctcgggagtgcgtgggctttggagctgtgcaggaggtggccgtggggctggtt
cagccggccagcgcggccctgtacgactactacaaccctgagcgcaagtgttctgtgttt
tacggagcaccgactaagagcaaactcttgtccacattgtgctccgctgatgtctgccag
tgtgccgaggggaagtgcccgaggcagcggcgcgccctggagcgcgggcagatggaggag
gatggctaccggatgcggttcgcctgctactacccccgagtggactacggcttccaggtg
aaggttctcagagaagattccagagctgctttccgcctcttcgagaccagtgtcacccaa
gtcctgcacttctccaaagacaccaaagccactgctggtcagacccgaaactttctggtt
cgagcctcttgccgccttcgcttggaacctggaaaagaatatttgatcatgggtctggat
ggggccacccatgacctcaacggacaaccccagtacctgctggactcgaacagctggatt
gaggagatgccctctgaacgcttgtgccggagcacccgccagcgggcagcctgtgcccag
ctccgcagcttcctgcaggagtatggcacccaggggtgccaggtttga

DBGET integrated database retrieval system