KEGG   Miniopterus natalensis (Natal long-fingered bat): 107539052
Entry
107539052         CDS       T05883                                 
Symbol
NPLOC4
Name
(RefSeq) nuclear protein localization protein 4 homolog
  KO
K14015  nuclear protein localization protein 4
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107539052 (NPLOC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mna03009]
    107539052 (NPLOC4)
Ribosome biogenesis [BR:mna03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    107539052 (NPLOC4)
SSDB
Motif
Pfam: NPL4 zf-NPL4 UN_NPL4 zf-RanBP
Other DBs
NCBI-GeneID: 107539052
NCBI-ProteinID: XP_016070913
LinkDB
Position
Unknown
AA seq 629 aa
MTGRTPCFIAWEHWWSVVTVLFHFQQIIRVQSPDGVKRITATKRETAATFLKKVAKEFGF
QNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSIAGPSSEMETSATLGLKA
FGAPNVVEDEIDQYLSRQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPV
KHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQK
YRHVDNIMFENHTVADRFLDFWRKTGSQHFGYLYGRYTEHRDIPLGIRAEVAAIYEPPQI
GTQNSLELLEDPKAEVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSAE
ECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDEC
LLPCKDAPELGYVKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKD
PVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSMFLDTISDFHLLLFLVTNEVM
PLQDSISLLLEAVRTRNEELAQTWKKSEQWATIEQLCSTVGVQLPGLQEYGAVGGSSHAA
TAAMWACEHCTFMNQPGTGHCEMCSLPRT
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgacgggccgcaccccgtgcttcatcgcctgggaacactggtggtctgtagtaaccgtc
ttgtttcacttccaacagataatccgtgtgcagtccccagatggggtgaagcggatcact
gcgacaaagagggagacagctgcaacatttctgaaaaaggttgcaaaggagtttggcttc
cagaataatggtttctcggtttacatcaatagaaacaagactggagagataacagcatca
tccaataagtccctcaacctgctgaaaatcaagcatggcgatttgctgttcctgtttccc
tcgagcattgctgggccctcatctgagatggagacatcagccacactggggttgaaggcc
ttcggtgctcccaacgtggtagaagatgagattgaccagtacctgagcagacaggacggg
aagatttaccggagccgcgacccacagctatgccgacacgggccgctggggaagtgcgtg
cactgtgttcctctggagccatttgatgaggactacctgaaccatctcgagccgcctgtg
aagcacatgtccttccatgcctacatccgaaagctgactggaggggctgacaaggggaag
tttgttgccctggagaacatcagttgcaagattaagtcagggtgcgagggacacctcccg
tggcccaatggtatctgcacgaagtgccagcccagcgccatcacactgaacagacagaaa
tacaggcatgtggacaatatcatgtttgagaaccacacagttgctgaccgcttccttgac
ttctggaggaagacgggaagccagcacttcgggtacttgtatggacggtacacggagcac
agggacattcctctgggcatccgggccgaggtggctgccatctacgaacctcctcagatt
gggacacagaacagcttggagcttcttgaagacccaaaagctgaggtggtggatgaaatc
gctgccaaacttggcctgaggaaggtcggctggatatttacagacctcgtttcagaagac
actcgaaagggtacagtccgatacagtcggaataaggacacctacttcctgagtgcggaa
gagtgcatcacggcaggggacttccagaacaagcaccccaacatgtgccggctctccccc
gatgggcactttggctccaagttcgtgactgcagtggccacaggtggtcccgacaaccag
gtccactttgaagggtaccaagtgtccaatcagtgcatggcgctggtccgggatgagtgc
ctgctgccctgcaaggacgcccccgagctcggctatgtcaaggagtccagcagtgagcag
tacgtgcctgatgtgttttataaggacatagacaagtttggcaatgagatcacccagctg
gcccgccctctgcccgtggagtatctcatcatagatatcacaaccactttccccaaggat
ccagtttatactttttctatttcgcaaaatccatttcctattgaaaaccgggatgtattg
ggggagacacaggacttccacagtcttgccacctacttgtcgcagaatacctcctccatg
ttcctggacaccatctcggatttccacctcctgctctttctggtcaccaacgaagtcatg
cctctgcaggacagcatcagcctgctcctggaggccgtgaggaccagaaacgaggagctc
gcccagacgtggaagaagtctgagcagtgggccaccatcgagcagctctgcagcacagtt
ggggtgcagcttccgggcctccaggagtatggtgccgtcgggggctcctcacacgccgcc
acggccgccatgtgggcctgtgagcactgcaccttcatgaaccagccgggcactggccac
tgcgagatgtgcagcctccccaggacctag

DBGET integrated database retrieval system