KEGG   Miniopterus natalensis: 107539442
Entry
107539442         CDS       T05883                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04068  FoxO signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04660  T cell receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05144  Malaria
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107539442 (IL10)
   04068 FoxO signaling pathway
    107539442 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107539442 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107539442 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107539442 (IL10)
   04660 T cell receptor signaling pathway
    107539442 (IL10)
   04672 Intestinal immune network for IgA production
    107539442 (IL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107539442 (IL10)
   05133 Pertussis
    107539442 (IL10)
   05150 Staphylococcus aureus infection
    107539442 (IL10)
   05152 Tuberculosis
    107539442 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107539442 (IL10)
   05144 Malaria
    107539442 (IL10)
   05145 Toxoplasmosis
    107539442 (IL10)
   05140 Leishmaniasis
    107539442 (IL10)
   05142 Chagas disease
    107539442 (IL10)
   05143 African trypanosomiasis
    107539442 (IL10)
  09163 Immune disease
   05310 Asthma
    107539442 (IL10)
   05322 Systemic lupus erythematosus
    107539442 (IL10)
   05320 Autoimmune thyroid disease
    107539442 (IL10)
   05321 Inflammatory bowel disease
    107539442 (IL10)
   05330 Allograft rejection
    107539442 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107539442 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107539442 (IL10)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107539442 (IL10)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Cytokines
   107539442 (IL10)
SSDB
Motif
Pfam: IL10 IL22 CLZ AMNp_N
Other DBs
NCBI-GeneID: 107539442
NCBI-ProteinID: XP_016071426
LinkDB
Position
Unknown
AA seq 178 aa
MPSSALLCCLVLLAGVGASRGRDSSSENSCTHLPTSLPHMLRELRTAFNRVKTFFQMKDQ
LDNILLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAESQGQNIKEHVNSLGEKLKTLR
LQLRRCYRFLPCENKSKAVEQVKSAFSKLQEKGIYKAMSEFDIFINYIETYMTMRMTN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagctcagcactgctgtgttgcctggtcctcctggccggggtgggggccagccga
ggccgggactcctcatctgagaacagctgcacccacctcccaaccagcctgccccacatg
cttcgagagctccgaactgccttcaacagggtgaagactttctttcaaatgaaggaccaa
ctggacaacatattgttgaacgggtccctgctggaagactttaagggttacctgggctgc
caggccttgtcagagatgatccagttttacctggaagaggtgatgccccaggctgagagc
cagggccagaacatcaaggagcacgtgaactcgctgggggagaagctgaagacgctcagg
ctgcagctccggcgctgttatcgctttctgccctgtgaaaataagagcaaagcagtggag
caggtgaagagtgcctttagtaagctccaagagaaaggcatctacaaagccatgagcgag
tttgacattttcatcaactacatagaaacctacatgacaatgaggatgaccaactga

DBGET integrated database retrieval system