KEGG   Miniopterus natalensis: 107539473
Entry
107539473         CDS       T05883                                 

Gene name
PIGR
Definition
(RefSeq) polymeric immunoglobulin receptor
  KO
K13073  polymeric immunoglobulin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    107539473 (PIGR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539473 (PIGR)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   107539473 (PIGR)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2
Other DBs
NCBI-GeneID: 107539473
NCBI-ProteinID: XP_016071464
LinkDB
Position
Unknown
AA seq 761 aa
MTLFFLACLLAVLPVVSMKSPIFGPQEMSRMEGSSASITCYYPDASVNRHSRKYWCKQGA
KGRCTTLISDSYVSKGYEGRASITDYPENNTFVVNIGHLTQSDSGSYKCGLGIINEGLSF
DVSLEVLPGPGLLNGTQVYTGKLGKTVTIKCPFKPENVMEVKSVFRELDGAEPYLVTDTT
GYVDNDYKDRVEISIMGTSQLEFSFVIKQLQLSDAGKYVCQAGPKNKNDRSNVYLHVLKP
EPQLLYGDLRGSVIFSCTLGPEEETLTKFLCRMSKGKACEVVVNTQGKMAEAFEGRILIA
PEDKTFFKVHIADLRKEDAGSYLCGAHATGGPQEGLSMQPWQLFINEDTRIPRSPSVVKG
VVGGSVAMLCPYNPKDRNSQKHWCRWDKENSDCTLLVSSEGLDEKQYEPYEGRLTLHEEP
GNGSYTVILNQLTAQDAGFYWCLTSGDTRWWFPVELKIVEGEPNLEAPKEATAWLGETLN
LPCRSPCKFYSYEKYWCKWSNEGCKALPSQQEGSRQASVNCDPNNQLTSLILNPVTKDDE
GWYWCGVKNGPRFGDTIAVHVAVKERAKASQDVNQLNAAPGKQKIEARAKNTEDIIQGPR
LFAEDVAGKDDGDLGDRSKALVDPGSSAGQGGSSTVLVSTLVPLALVLALGALAVAVVRA
RHRRNVDRVSIGSYRTDFSMSDLESSRDFGANDNMGASSVVQETSLGGKDELSATTEDTK
DTDEPKKAKRSSKEEADMAHTAFLLQANQMVTSVQDGPSEA
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgacgctcttcttcctcgcctgcctgctggctgtcctcccagtggtctccatgaagagt
cccatttttggtccccaggagatgagcagaatggaaggcagctcggcttccatcacctgc
tactacccagacgcctccgtcaaccggcactctcggaagtactggtgcaagcagggagcc
aagggccgttgcacaaccctcatctcggatagctacgtctccaagggctacgagggcaga
gccagtatcaccgactacccagagaataacacgtttgtggtaaacattggccatctcacc
cagagtgactctgggagctacaagtgtggtttgggcattattaacgaaggcctgtccttt
gatgtgagcctggaggtcctcccaggtcctgggctcctaaatggcactcaagtctataca
ggaaaactgggcaaaacagtgaccatcaaatgccctttcaagcctgagaatgtaatggag
gtaaagtctgtgttcagggagttagatggcgccgaaccttacctagtcaccgacaccact
gggtatgtggacaacgactacaaggacagagttgagatctctattatgggcaccagccaa
ctagaattcagcttcgtcatcaagcaactccagctcagtgatgcagggaagtatgtctgc
caggctgggcctaaaaataaaaatgacagaagcaatgtttacctgcacgtgctgaagccg
gagcctcagctgctttatggagacctgaggggctcagtgatcttctcctgtaccctgggc
ccagaggaggaaactctgaccaaatttctgtgccggatgagcaaagggaaagcctgcgaa
gtggtcgtcaatacgcaggggaagatggctgaggcctttgagggaaggatcctgattgct
cctgaggacaaaaccttcttcaaggtgcacattgctgacctgaggaaagaagacgcaggg
agctacctgtgtggggcccacgccactggtggccctcaggaaggcttgtccatgcagcct
tggcaactcttcatcaatgaagacacgaggatcccccgaagtccctccgtggtgaaaggt
gtggttggaggctctgtggccatgctctgcccatacaaccctaaggacagaaatagccag
aagcactggtgtcgctgggataaggagaacagtgactgcaccctgctggtgagcagcgag
ggcctggatgagaagcaatacgaaccctacgagggcaggctcaccctgcacgaagagccc
ggcaacggctcctacacagtcattctcaaccagctcaccgcccaggacgccggcttctac
tggtgtctgaccagcggtgacactcgctggtggttcccagtggagctcaagattgttgag
ggagagccaaacctcgaggcacccaaggaggccactgcttggctgggagagactctcaat
ctgccttgccgctcgccctgcaaattctactcctacgagaaatactggtgcaagtggagc
aacgaaggttgcaaggcactgcccagccaacaggagggctccaggcaggcctctgtgaac
tgcgacccgaacaaccagctcacctccctgatcctgaacccagtcaccaaggacgatgag
gggtggtactggtgcggggtgaagaatggcccccgatttggagacaccatcgctgtccac
gtggcggtcaaggagagggcaaaggcgtcccaagatgtcaaccaactgaatgcggctcct
ggcaagcaaaagatagaggcacgtgccaagaacactgaggacatcattcagggtcccagg
ctttttgcagaagatgtagcagggaaggatgatggagacctgggagacaggagcaaagca
cttgtagatcctggcagctctgcaggacaaggagggagctccacagtgctggtctccacc
cttgtgcccctggccctggtgctggcactgggggccttggcggtggcagtggttagagcc
cgacacaggaggaacgttgaccgggtttccattggaagctacaggacagactttagcatg
tcggacttggagagctccagggatttcggagccaatgacaacatgggagcctcttcggtt
gttcaggagacatctcttggaggaaaagatgagctctcggccaccactgaggacaccaag
gacactgatgagcccaagaaggccaagaggtcctccaaggaggaagctgacatggcccac
accgccttcctgctccaggccaaccagatggtgaccagcgtccaggacggccccagcgaa
gcctag

DBGET integrated database retrieval system