KEGG   Miniopterus natalensis: 107539494
Entry
107539494         CDS       T05883                                 

Symbol
MYC
Name
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04110  Cell cycle
mna04151  PI3K-Akt signaling pathway
mna04218  Cellular senescence
mna04310  Wnt signaling pathway
mna04350  TGF-beta signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04630  JAK-STAT signaling pathway
mna04919  Thyroid hormone signaling pathway
mna05132  Salmonella infection
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05213  Endometrial cancer
mna05216  Thyroid cancer
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107539494 (MYC)
   04012 ErbB signaling pathway
    107539494 (MYC)
   04310 Wnt signaling pathway
    107539494 (MYC)
   04350 TGF-beta signaling pathway
    107539494 (MYC)
   04390 Hippo signaling pathway
    107539494 (MYC)
   04630 JAK-STAT signaling pathway
    107539494 (MYC)
   04151 PI3K-Akt signaling pathway
    107539494 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107539494 (MYC)
   04218 Cellular senescence
    107539494 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107539494 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107539494 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539494 (MYC)
   05202 Transcriptional misregulation in cancer
    107539494 (MYC)
   05206 MicroRNAs in cancer
    107539494 (MYC)
   05205 Proteoglycans in cancer
    107539494 (MYC)
   05207 Chemical carcinogenesis - receptor activation
    107539494 (MYC)
   05230 Central carbon metabolism in cancer
    107539494 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107539494 (MYC)
   05225 Hepatocellular carcinoma
    107539494 (MYC)
   05226 Gastric cancer
    107539494 (MYC)
   05216 Thyroid cancer
    107539494 (MYC)
   05221 Acute myeloid leukemia
    107539494 (MYC)
   05220 Chronic myeloid leukemia
    107539494 (MYC)
   05219 Bladder cancer
    107539494 (MYC)
   05213 Endometrial cancer
    107539494 (MYC)
   05224 Breast cancer
    107539494 (MYC)
   05222 Small cell lung cancer
    107539494 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107539494 (MYC)
   05161 Hepatitis B
    107539494 (MYC)
   05160 Hepatitis C
    107539494 (MYC)
   05163 Human cytomegalovirus infection
    107539494 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107539494 (MYC)
   05169 Epstein-Barr virus infection
    107539494 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107539494 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107539494 (MYC)
   03019 Messenger RNA biogenesis [BR:mna03019]
    107539494 (MYC)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107539494 (MYC)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107539494 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 107539494
NCBI-ProteinID: XP_016071480
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFANRNYDLDYDSMQPYFFCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
RSPSRRSGLCSPSYVAFASFSPREVDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGGRSPARGHGACSTSSLYLQD
LSAAASECIDPSVVFPYPLNDGGSPKPCASPDSSAFSPSSDSVLSSATSSPRASPEPLAL
HEDTPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSPSAGSHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPPAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILAVQAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacagaaactatgacctcgactacgactccatgcag
ccctatttcttctgcgacgaggaggagaacttctaccaccagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
cgctcgcccagccgccgctcgggactctgctcgccctcctatgtcgcgttcgcgtccttc
tcacccagggaggttgacgacggcggcggcggcagcttttccaccgcagaccagttggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgcatgtggagcggcttctccgca
gccgccaagctggtctcggagaagctggcctcctaccaggcggcgcgcaaagacggcggc
ggccgaagccccgcccgagggcacggcgcctgctccacctccagcctgtacctgcaggac
ctgagcgccgccgcctccgagtgcatcgacccctccgtggtcttcccctacccgctcaac
gacggcggctcgcccaagccctgcgcctcccccgactccagcgccttctccccgtcctcg
gactctgtgctgtcctcggccacctcctccccgcgggccagccccgagcccctggcgctg
cacgaggacacaccacccaccaccagcagcgactccgaggaagaacaagaggatgaagaa
gaaatcgatgtcgtttctgtggaaaagaggcagacccctgccaaaaggtcagaatcgggg
tcaccctctgcgggaagtcacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtgtccacccatcagcacaactacgcagcacccccctccaccaggaaggactatccc
cccgccaagagggccaagttggacagtggccgagtcctgaaacagatcagcaacaaccgc
aaatgtgccagccccaggtcctcggacacggaggagaatgacaagaggcggacacacaac
gtcctggaacgccagaggaggaatgagctgaaacgcagcttcttcgccctgcgcgaccag
atcccagagttggaaaacaacgaaaaggcccccaaggtagttatccttaaaaaagccacc
gcgtacatcctggccgtccaagcagaggagcagaagctcatttcagagaaggacttgttg
cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system