KEGG   Miniopterus natalensis (Natal long-fingered bat): 107539557
Entry
107539557         CDS       T05883                                 
Symbol
TRAM1
Name
(RefSeq) translocating chain-associated membrane protein 1
  KO
K14010  translocating chain-associated membrane protein 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107539557 (TRAM1)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Other DBs
NCBI-GeneID: 107539557
NCBI-ProteinID: XP_016071573
LinkDB
Position
Unknown
AA seq 287 aa
MLVAIIIHAIIQEYVLDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGTFILVSENYI
SDPTILWRSYPPNLMTFQVKFFYILQLAYWFHAFPELYFQKTKKEDIPRQLVYIGLYLFH
IAGAYLLNLNHLGLVLLVPHYFVEFLFHISRLFYFTDEKYQKGFSLWAVLFVLGRLLTLI
LSVLTVGFGLARAENQKLDFSTGNFNVLGIRIAVLASICITQAFMMWKFINFQLRRWREH
SAFQAPTVKKKPAVTKGRSRKGTENGVNGTVTSNGADSPRNRKEKSS
NT seq 864 nt   +upstreamnt  +downstreamnt
atgctagtggcgataattattcatgccataattcaggagtatgtgttggataaaattaac
aggcgaatgcacttctccaaaacgaaacacagcaagtttaatgaatctggtcagcttagt
gcattctacctattttcttgtatttggggcacattcattctagtatctgaaaactacatc
tcagacccaacaattttgtggaggtcttatccccctaacctgatgacatttcaggtgaag
tttttctacatattacagctggcttactggtttcatgcttttcctgagctctacttccag
aaaaccaaaaaagaggatattcctcggcagcttgtctacataggtctttacctctttcac
attgctggagcttatcttttgaacttgaatcatctaggacttgttcttttggtgccgcat
tattttgttgaatttcttttccacatttcccgcctgttttatttcactgatgaaaagtac
cagaaaggattttctctgtgggcagttctgtttgttttgggaagacttctgactttaatt
ctttcggttctcactgttggctttggtcttgcaagagcagagaaccagaagctggatttc
agtactggaaacttcaatgtgttgggtataagaattgcagttctggcatcgatttgcatc
acccaagcattcatgatgtggaagttcattaattttcagcttcgcaggtggagggaacat
tctgcttttcaggcaccaactgtgaagaagaaaccagcagtgacaaaaggcagatctaga
aaaggaacagaaaatggtgtaaatggaacagtaacttcaaatggagcagactctccccgt
aatagaaaagagaaatcttcataa

DBGET integrated database retrieval system