KEGG   Miniopterus natalensis: 107540176
Entry
107540176         CDS       T05883                                 

Symbol
CISH
Name
(RefSeq) cytokine-inducible SH2-containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
mna  Miniopterus natalensis
Pathway
mna04630  JAK-STAT signaling pathway
mna04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107540176 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    107540176 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107540176 (CISH)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     107540176 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 107540176
NCBI-ProteinID: XP_016072357
LinkDB
Position
Unknown
AA seq 301 aa
MSLTPRKPRVILLEGKLRLIVRSTGHSHVAGLGHGGLWKWEGAGLPLTAHLPTSRSCPLL
AVERIGQRPLWAQPEPAMRPLPAGAFLEEVAEETPAQPENEPKVLDPEEDLLCIAKTFSY
LRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADS
SFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAPTPALPVSKEEAPGDTA
LPAPAATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVPDVDCLPLPRRMADYLRQYPFQ
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atgtccctcactcccaggaagcccagggtcatcctgctggaagggaagctaaggctcata
gtgagatcgactggacacagtcatgtagccggtctggggcatgggggtctttggaagtgg
gagggtgcagggctcccactcactgcccacctacccacttctagatcttgtcctttgctg
gctgtggagcggattgggcagcggcccctgtgggcccagcctgagccagctatgcggcct
ctgcctgccggggccttcctggaggaggtagcagaggagaccccagcccagccagagaat
gagcccaaggtgctagacccagaggaagatctgctctgcatagccaagaccttttcctac
cttcgggaatctggctggtattggggttccattactgccagcgaggcccggcagcacctg
cagaagatgccagaggggacattcctagtacgtgacagcacccaccccagctacctgttc
acactgtcggtcaaaaccacccgtggccccaccaacgtgcgcattgagtacgccgactcc
agcttccgcctggactccaactgcctgtcccggccacgcattctggccttcccagatgtg
gtcagccttgtgcagcactacgtggcctcctgtgctgctgacacccgaagcgacagccct
gaccctgcccccacgcccgccctgcctgtctctaaggaagaggcgcctggtgacacagcg
ctgccagcccccgcagctaccgcggtgcatctgaaactggtgcagcccttcgtgcgcagg
agcagtgcccgcagcctgcagcacctgtgtcgcctggtcatcaaccgcctggtgcccgac
gtggactgcctgccactgccccggcgcatggccgactacctccgacagtaccccttccag
ctctga

DBGET integrated database retrieval system