KEGG   Miniopterus natalensis: 107540295
Entry
107540295         CDS       T05883                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01523  Antifolate resistance
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04218  Cellular senescence
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04623  Cytosolic DNA-sensing pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna04657  IL-17 signaling pathway
mna04659  Th17 cell differentiation
mna04668  TNF signaling pathway
mna04672  Intestinal immune network for IgA production
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05134  Legionellosis
mna05135  Yersinia infection
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05144  Malaria
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05321  Inflammatory bowel disease
mna05323  Rheumatoid arthritis
mna05332  Graft-versus-host disease
mna05410  Hypertrophic cardiomyopathy
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107540295 (IL6)
   04668 TNF signaling pathway
    107540295 (IL6)
   04066 HIF-1 signaling pathway
    107540295 (IL6)
   04068 FoxO signaling pathway
    107540295 (IL6)
   04151 PI3K-Akt signaling pathway
    107540295 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107540295 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107540295 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107540295 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107540295 (IL6)
   04620 Toll-like receptor signaling pathway
    107540295 (IL6)
   04621 NOD-like receptor signaling pathway
    107540295 (IL6)
   04623 Cytosolic DNA-sensing pathway
    107540295 (IL6)
   04625 C-type lectin receptor signaling pathway
    107540295 (IL6)
   04659 Th17 cell differentiation
    107540295 (IL6)
   04657 IL-17 signaling pathway
    107540295 (IL6)
   04672 Intestinal immune network for IgA production
    107540295 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540295 (IL6)
   05202 Transcriptional misregulation in cancer
    107540295 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107540295 (IL6)
   05161 Hepatitis B
    107540295 (IL6)
   05171 Coronavirus disease - COVID-19
    107540295 (IL6)
   05164 Influenza A
    107540295 (IL6)
   05162 Measles
    107540295 (IL6)
   05168 Herpes simplex virus 1 infection
    107540295 (IL6)
   05163 Human cytomegalovirus infection
    107540295 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107540295 (IL6)
   05169 Epstein-Barr virus infection
    107540295 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107540295 (IL6)
   05135 Yersinia infection
    107540295 (IL6)
   05133 Pertussis
    107540295 (IL6)
   05134 Legionellosis
    107540295 (IL6)
   05152 Tuberculosis
    107540295 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107540295 (IL6)
   05144 Malaria
    107540295 (IL6)
   05142 Chagas disease
    107540295 (IL6)
   05143 African trypanosomiasis
    107540295 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107540295 (IL6)
   05321 Inflammatory bowel disease
    107540295 (IL6)
   05332 Graft-versus-host disease
    107540295 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107540295 (IL6)
   05020 Prion disease
    107540295 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    107540295 (IL6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107540295 (IL6)
   05410 Hypertrophic cardiomyopathy
    107540295 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107540295 (IL6)
   04931 Insulin resistance
    107540295 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107540295 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107540295 (IL6)
   01523 Antifolate resistance
    107540295 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107540295 (IL6)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107540295 (IL6)
SSDB
Motif
Pfam: IL6 IL11 GCSF DUF4924
Other DBs
NCBI-GeneID: 107540295
NCBI-ProteinID: XP_016072497
LinkDB
Position
Unknown
AA seq 208 aa
MNSLPTSTFSPVAFSLGLLLVTATAFPTPLPLGEDSKEDTASIRPPLTSSEQIENLIKPI
LLEILEVKNKMCDNHESCKNSKEVLTENNLNLPKLTKKDGCFHSGFNQETCFTRLTTGLQ
EFQVYLEYLQDTFEENARAMKMRTKALVKILKQKMNNPVEETIPHPTTNAGLLKEMQSQK
EWLKTTTIHLILRSFEDFLQFTQRAIRM
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaactctctccccacaagcaccttcagtccagtggccttctccctggggctgctcctg
gtcacggctactgctttccccaccccgcttcccctgggagaagattccaaagaggacacc
gcctcaattagaccaccactcacctcttcagagcaaattgaaaacctcattaagcccatc
ctcctggaaatcttggaggttaaaaacaagatgtgtgacaaccacgaatcgtgtaaaaac
agcaaggaagtactgacagaaaacaacctgaatctcccaaaactgaccaaaaaagatggg
tgcttccactccggattcaatcaggagacctgcttcacgagactcaccaccggtcttcag
gagttccaggtgtacctggagtacctccaggacacgtttgaggaaaatgccagggccatg
aagatgagaaccaaagccctggtcaagatcctgaagcaaaagatgaataatccagtcgaa
gaaaccatccctcacccaaccacaaatgccggcctgctgaaggagatgcagtcgcagaaa
gagtggctcaagaccacgaccattcacctcatcctgcggagcttcgaggacttcctgcag
ttcacccagagggccatccggatgtag

DBGET integrated database retrieval system