KEGG   Miniopterus natalensis: 107540309
Entry
107540309         CDS       T05883                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8
  KO
K06591  integrin beta 8
Organism
mna  Miniopterus natalensis
Pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04512  ECM-receptor interaction
mna04514  Cell adhesion molecules
mna04810  Regulation of actin cytoskeleton
mna05165  Human papillomavirus infection
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107540309 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107540309 (ITGB8)
   04514 Cell adhesion molecules
    107540309 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107540309 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107540309 (ITGB8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107540309 (ITGB8)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107540309 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107540309 (ITGB8)
   05414 Dilated cardiomyopathy
    107540309 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107540309 (ITGB8)
   04515 Cell adhesion molecules [BR:mna04515]
    107540309 (ITGB8)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107540309 (ITGB8)
Cell adhesion molecules [BR:mna04515]
 Integrins
  Integrin beta subunits
   107540309 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 EGF_Tenascin
Other DBs
NCBI-GeneID: 107540309
NCBI-ProteinID: XP_016072512
LinkDB
Position
Unknown
AA seq 767 aa
MCCSALAFFTAAFVCLQNCRPGPAPFLRAAWVFAVGLGLGQSENSRCASSNAVSCTRCLA
LGPECGWCAQEDFISGGSRSERCDTVSNLISKGCSIESIEYPSVHVIPVENEINTQVTPG
DVLVQLRPGAHANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSKKMAFFS
RDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNIYVRSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVKGIHLNITAICPDGTRRPGTEGCGN
VTSNDEVFFNVTVTMKKCDVTGGKNYAIIKPIGFNETTKIHIHRNCSCQCDNSRGPKRKC
VDETFLDSKCFQCDENKCHFDEDQFPSESCKSHKDQPVCSGRGVCICGKCLCHKIKLGKV
YGKYCEKDDFSCPYHHGSLCAGHGECEAGRCQCFSGWEGDRCQCPSTSAQHCINSKGQVC
SGRGTCVCGKCECTDPRSIGRFCEHCPTCHTACNENWNCVQCLHPHNLSQAILDRCKSSC
AFVEQHYMDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSADY
RVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtgctgctcggccctggctttttttactgccgcatttgtctgcctgcaaaactgccgg
ccaggtcctgccccgttcctccgggcggcctgggtgtttgcagttggtcttggactgggc
cagagtgaaaacagcagatgtgcatcttccaatgcagtatcctgcaccaggtgccttgcg
ctgggtccagaatgtggatggtgtgctcaagaggatttcatttcaggtggatcaaggagt
gaacgttgtgatactgtttccaatttaataagtaaaggatgctcgattgagtcaatagaa
tacccgtctgtgcatgtaataccagttgaaaatgaaattaatacccaggtgacaccagga
gacgtgttggtccagctgcgtccaggagctcatgctaattttatgctgaaagttcatcct
ctgaagaaatatcctgtggatctttattatctggtcgatgtctcagcatcaatgcataat
aatattgaaaaattaaattctgttgggaatgatttatctaaaaaaatggcatttttctcc
cgtgacttccgtcttggatttggctcatacgttgataaaacagtttcaccatacattagc
atccacccagaaaggattcataatcaatgcagtgactacaatttagactgtatgccgcct
catgggtacatccacgtgctgtctttgacagagaacatcactgagtttgaaaaggcagtt
catagacagaagatctctggaaatatcgatacacctgaaggaggttttgatgctatgctt
caggcagctgtctgtgagagtcatattggatggcgaaaggaagctaaaagattgctgctg
gtgatgacagaccagacatctcatcttgctcttgatagcaaattggcaggcatagtggtg
ccaaacgatggaaactgccatctgaaaaacaacatctacgtcagatcaacaagcatggaa
catccctcactaggccaactctcagaaaagttaatagacaacaacattaatgtcatcttt
gcagttcaaggaaaacagtttcattggtataaggaccttctgcccctcttgcctggtacc
attgctggtgaaatagaatccaaagctgcaaacctcaataatttggtagtagaagcctat
cagaaacttatttcagaagtgaaagttcaagtggaaaaccaggtgaaaggcatccatttg
aacatcactgccatctgtccagatgggaccagaaggccaggcacagaaggatgcggaaac
gtgacgagcaatgacgaagtttttttcaatgtaacagttacaatgaaaaaatgtgatgtc
acaggaggaaaaaactatgcaataatcaaacctattggtttcaatgaaaccactaaaatt
catatacacagaaactgcagctgtcagtgtgataacagcagaggacctaaaagaaagtgt
gtagatgaaacttttctagactccaaatgtttccagtgtgatgagaataaatgtcatttt
gatgaagatcaattcccttctgagagttgcaagtcacacaaggatcaacctgtttgcagt
ggtcgaggagtttgtatttgtgggaaatgtttgtgtcacaaaattaagcttggaaaagta
tatggaaaatactgtgaaaaggatgacttttcttgtccatatcaccatggaagcctgtgt
gctgggcatggagagtgtgaagcaggcagatgccagtgcttcagtggctgggaaggagat
aggtgccagtgcccatcaacttcagcccagcactgtatcaattctaaggggcaagtgtgc
agtggaagaggcacctgtgtctgcggcaagtgtgagtgcaccgatcccaggagcatcggc
cgcttctgtgagcactgccccacgtgtcacacagcctgcaatgaaaactggaattgtgtg
caatgccttcacccccacaatctgtctcaagctatacttgatcggtgtaaatcctcatgt
gctttcgtggaacagcattatatggaccaaacatcagaatgcttctctagcccaagctac
ttgaggatatttttcatcattttcatagttacattcttgattgggctgcttaaagtcctt
atcattagacaggtgatattacaatggaatagtaataaaataaagtcctcagcagattac
agggtgtcggcctcaaaaaaggacaagttgattctgcaaagtgtttgcacaagagcagta
acctaccgacgtgagaagcctgaagaaataaaaatggatatcagcaaattaaatgctcat
gaaactttcaggtgcaacttctga

DBGET integrated database retrieval system