KEGG   Miniopterus natalensis (Natal long-fingered bat): 107540549
Entry
107540549         CDS       T05883                                 
Symbol
MARCH6
Name
(RefSeq) E3 ubiquitin-protein ligase MARCH6
  KO
K10661  E3 ubiquitin-protein ligase MARCH6 [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107540549 (MARCH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107540549 (MARCH6)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107540549 (MARCH6)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   March proteins
    107540549 (MARCH6)
SSDB
Other DBs
NCBI-GeneID: 107540549
NCBI-ProteinID: XP_016072807
LinkDB
Position
Unknown
AA seq 842 aa
MPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFTGSVSSLLT
LPLDMLSTDNLLADCLQGCFVVTCTLCAFISLVWLREQIVHGGAPIWLEHAAPPFNAAGH
HQNEAPAGGNGVENVAPDQPANPPAENAVVGENPEAQDDQAEEEEEENEEEDEAAGEDAA
DANNGAQDDMNWNALEWDRAAEELTWERMLGLDGSLVFLEHVFWVVSLNTLFILVFAFCP
YHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIICHGLATLVKFHRSRRLLGV
CYIVVKVSLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTTMFLHWLVG
MVYVFYFASFILLLREVLRPGVLWFLRNLNDPDFNPVQEMIHLPIYRHLRRFILSVIVFG
SIVLLMLWLPIRIIKSLLPNFLPYNVMLYSDAPVSELSLELLLLQVVLPALLEQGHTRQW
LKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAH
QAILQQGGPVGFQPYRRPLNFPLRIFLLIVFMCITLLIASLICLTLPVFAGRWLMSFWTG
TAKIHELYTAACGLYVCWLTIRAVTVLVAWMPQGRRVIFQKVKEWSLMIMKTLIVAVLLA
GVVPLLLGLLFELVIVAPLRVPLDQTPLFYPWQDWALGVLHAKIIAAITLMGPQWWLKTV
IEQVYANGIRNIDLHYIIRKLAAPVISVLLLSLCVPYVIASGVVPLLGVTAEMQNLVHRR
IYPFLLMVVVLMGILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGTSSPPPQSS
QE
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgccttcacggcttccaatccaagacatatttgctggactggttacaagtattggcact
gcaatacgatattggtttcattatacacttgtggccttcgcatggttgggagttgttcct
ctcacagcatgccgcatctacaagtgcttgtttactggctccgtgagctcattactgaca
ctgccactggacatgctgtctacggacaacttattggcggattgtttgcagggttgtttt
gtggtaacttgcacattgtgcgcattcatcagcctggtgtggttgcgagagcagatcgtc
catgggggagcaccaatttggttggaacatgctgctccgcccttcaatgctgctggacac
caccaaaatgaggctccagcgggaggaaatggtgttgaaaatgttgcccctgaccagcct
gccaacccaccagctgagaatgcagtggtgggggagaaccctgaggcccaggatgatcag
gcagaagaggaggaggaggagaatgaggaggaagatgaggcagccggggaagatgcagcg
gatgccaacaatggggcccaggatgacatgaactggaatgctttagaatgggacagagct
gcagaagagcttacatgggaaagaatgctaggccttgatggatcactagtttttctagaa
catgtcttctgggtggtgtctttaaatacactgttcattcttgtttttgcattttgccct
taccacattggtcatttctcccttgttggtttgggatttgaagaacatgttcaagcatct
cattttgaaggcctaatcacaaccatagttgggtatatacttttagcaataacactgatc
atttgtcatggcttggcaactcttgttaaatttcataggtctcgtcgcttgctgggagtc
tgctatattgttgttaaggtctctttgctagtggtagtagaaattggagtgttccctctc
atttgtggctggtggctggatatctgttccctggaaatgtttgatgctactctgaaagat
cgagaactgagctttcaatcagctccaggtactaccatgtttctgcactggctggtggga
atggtgtacgtgttctactttgcctccttcattcttttactgagagaggtacttcgacct
ggtgtcttgtggtttctaaggaatttgaatgatccagattttaatccagtacaagaaatg
atccatttgcccatttatagacatcttcgaagatttattttgtcagtgattgtgtttggc
tccattgtccttctgatgctttggcttcctatacgtataattaagagtctgctgcctaat
tttctgccatacaatgtcatgctctacagtgatgctccggtgagtgaactgtcccttgag
ctgcttctgcttcaggttgtcctgccagcattacttgaacagggacacacacggcagtgg
ctgaaggggcttgtgcgagcctggactgttactgctggatacttgctggatcttcattcc
tatttattgggcgaccaggaagaaaatgagaacagtgcaaaccaacaagttaacaataac
cagcatgctcgaaataacaacgctattcctgtggtgggggaaggcctgcatgcagcccac
caagccatactccagcagggagggcctgttggctttcagccttatcgccggcctttaaat
tttccactcaggatatttttgttgattgtcttcatgtgcataaccttactgattgccagc
ctcatctgccttactctaccagtatttgctggccgctggttaatgtcattttggacaggg
actgccaaaattcatgagctgtacacagctgcttgtggtctgtatgtttgctggctcacc
ataagggcagtgacagtgctggtggcatggatgccccaaggacgaagagtgatcttccag
aaggttaaagagtggtccctcatgataatgaagactttgatagttgcggtgctgctggct
ggagttgtcccgctccttctgggactcctgtttgagctggttattgttgctcccctgcgg
gttcccttggatcagactcctcttttttacccatggcaggactgggcactgggagtcttg
cacgccaaaatcattgcagctataacattgatgggtcctcagtggtggttgaaaactgtg
attgagcaggtttatgcaaatggcatccgaaacattgatcttcactatatcattcgtaaa
ctggcagcgcctgtgatttctgttctcttgctttccctgtgtgtaccttatgtcattgca
tccggtgttgttcctctactaggtgttactgcggaaatgcaaaacttggtccaccggcgg
atttatccattcttactgatggttgtggtgttgatggggatcttgtccttccaggtccgc
cagtttaagcgcctttatgaacatattaaaaatgacaagtaccttgtgggccaacgcctt
gtgaactatgaacggaaatctggcaaacaaggcacatcttcgccacctccacagtcgtcc
caagaataa

DBGET integrated database retrieval system