KEGG   Miniopterus natalensis: 107540599
Entry
107540599         CDS       T05883                                 

Gene name
JAM3
Definition
(RefSeq) junctional adhesion molecule C isoform X1
  KO
K06785  junctional adhesion molecule 3
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107540599 (JAM3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107540599 (JAM3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107540599 (JAM3)
SSDB
Motif
Pfam: Ig_3 I-set V-set ig Ig_2 Ig_6 C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 107540599
NCBI-ProteinID: XP_016072873
LinkDB
Position
Unknown
AA seq 310 aa
MALRRRRGPRLCVRLPDFLLLLLLRGCLVGAVNLKSSNRTPVAQEFESVELSCIITDSQT
NDPRIEWKKIKDAQTTYVYFDNKVQGDLAGRAELLGQTSLKIWNVTRKDSALYRCEVVAR
NDRKEMDEIVIELIVQVKPVPPVCRVPKAVPVGKAATLRCQEEEGFPRSRYSWYRNDAPL
PRDSRANPRFQNSSFLVNPETGTLVFNSVHKGDSGRYHCIASNDAGSAKCAAQEMEVYDL
NVGGIIGGVLVVLAVLTLITVGICCAYRRGYFVNNKQNAESYKSPGRPDGVNYIRTGEEG
DFRHKSSFVI
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcgctgaggcggcggcgggggccgcggctctgcgtgcggctgcccgacttcctgctg
ctgctgctcctcaggggctgcttggtaggggctgtgaatctcaaatccagcaacagaacc
ccagtggcacaggagtttgaaagtgtggagctgtcttgcatcattacagattcccaaacg
aatgaccccaggattgaatggaagaaaattaaagatgctcaaaccacatacgtgtatttt
gacaacaaagtacagggggacttggcaggccgtgcggaactgttggggcaaacctctcta
aagatctggaatgtgacccggaaggactccgctctttatcgctgtgaggtggtggctcga
aacgaccgcaaagaaatggacgagattgtcattgagttaattgtgcaagtgaagccagta
cctccagtgtgcagagtgccgaaggctgtgcctgtgggcaaggcggccacgctgcgctgc
caggaggaggagggcttcccccgctcccgatacagctggtaccgcaatgacgcgcccctg
cccagggactccagggccaacccccggttccagaactcttccttcctcgtgaacccggag
acgggcactctggttttcaactccgttcacaagggagactccgggcggtatcactgcatc
gcgtccaatgacgcgggctcggccaagtgtgcggcgcaggagatggaagtctacgacctg
aacgtgggcgggatcatcggcggggtgctggttgtcctcgccgtgctgaccctgataaca
gtgggcatctgctgtgcgtacagacgcggctacttcgtcaacaacaagcagaatgcggaa
agctacaagagtccagggaggcccgacggagtcaactacatcaggacaggcgaggagggc
gacttcagacacaagtcgtcgtttgtgatctga

DBGET integrated database retrieval system