KEGG   Miniopterus natalensis (Natal long-fingered bat): 107540989
Entry
107540989         CDS       T05883                                 
Symbol
FBXO2
Name
(RefSeq) F-box only protein 2
  KO
K10099  F-box protein 2
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107540989 (FBXO2)
   04120 Ubiquitin mediated proteolysis
    107540989 (FBXO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107540989 (FBXO2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107540989 (FBXO2)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107540989 (FBXO2)
Lectins [BR:mna04091]
 F-box lectins
  107540989 (FBXO2)
SSDB
Motif
Pfam: FBA
Other DBs
NCBI-GeneID: 107540989
NCBI-ProteinID: XP_016073375
LinkDB
Position
Unknown
AA seq 261 aa
MDGDGDPESMGQPEEASSDEQQQEEGCPGAAEESAGDEAEAEAEAEAAYLAELPEPLLLR
GLVPEGGSEDERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDC
GLDFVHDESVKKFFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGC
LYELTVRLLSEHEDVLAEFSTGQVAVPQISDNGGWIEVSHTFTDYGPGVRFVRFEHGGQD
SVYWKGWFGARVTNSSVWVEP
NT seq 786 nt   +upstreamnt  +downstreamnt
atggacggagacggtgacccagagagcatgggccagcctgaggaggcgagctcggatgag
cagcagcaggaggaagggtgcccgggcgcggcggaggagagcgccggggacgaggcggag
gcggaggcggaggcggaggccgcctacctggccgagctgcccgagccgctgctgctgcgc
gggctggtgcccgagggcggctcggaggacgagcgcgaccactggcagcagttctacttc
ctgagcaagaggcggcgcaacttgctgcgcaacccgtgcggggaagaggacctggagggc
tggtgcgacgtggagcacggcggggacggctggcgcgtggaggagctgcccggagactgt
gggctggacttcgtccacgacgagagcgtcaagaagttcttcgcctcctcctttgagtgg
tgtcgcaaagcgcaggtcattgacctgcaggccgagggctactgggaggagctgctggac
accactcagccggccatcgtggtgaaggactggtactcgggccgcagcgacgccggctgc
ctgtacgagctgaccgtgcggctgctgtccgagcacgaggacgtgctggccgagttcagc
accgggcaggtggcagtgccgcaaatcagcgacaacggaggctggatcgaggtctcgcac
actttcaccgactacgggcccggcgttcgcttcgtccgcttcgagcacgggggacaggac
tccgtctactggaagggctggttcggggcccgcgtgaccaacagcagcgtgtgggtggag
ccctga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107540999
Entry
107540999         CDS       T05883                                 
Symbol
FBXO6
Name
(RefSeq) F-box only protein 6
  KO
K10100  F-box protein 6
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107540999 (FBXO6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107540999 (FBXO6)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107540999 (FBXO6)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107540999 (FBXO6)
Lectins [BR:mna04091]
 F-box lectins
  107540999 (FBXO6)
SSDB
Motif
Pfam: FBA F-box-like F-box
Other DBs
NCBI-GeneID: 107540999
NCBI-ProteinID: XP_016073386
LinkDB
Position
Unknown
AA seq 306 aa
MALVSINELPENILLEVFTYLPARQLLLRCRLVCTLWRDLIDLVTLWKRKCLREGFIPED
WDQPVADWKIFYFLCSVRRNLLRNPCAEEGMRSWKIDENGGDCWKVESLPGAHGKDFPDS
KVRNYFVTSYALCLKSQMVDLKAKGYWEELMDVFRPDIVVKDWFAARADCGCTYNIKVQL
LSANNIPLASFEPPPVTIEQWSDATWTEVSYTFSDYPPGVRHVFFQHGGKDTQFWAGWYG
PRVTNSSIIISPKMTRNPTNACHSSAVTLTDQEQERGQAQGQGKGKGKGKECTDYLPSVL
HFYKRF
NT seq 921 nt   +upstreamnt  +downstreamnt
atggccctggtcagcatcaatgaactgcctgagaacatcctgctggaggtgttcacatac
ctgcccgcccgccagctgctgctgcgctgccgcttggtctgcaccctctggcgcgacctc
atagacctcgtgaccctctggaaacgcaaatgcctgcgtgagggcttcatcccggaggac
tgggaccagcctgtggccgactggaagattttttactttctatgcagcgtccgcaggaac
ctcctacgcaacccatgtgctgaagagggcatgagatcctggaaaatcgacgagaatgga
ggggactgttggaaggtggagagcttacctggagcccatgggaaagattttcctgactcc
aaagtcaggaactactttgtcacatcctatgcattatgcctcaagtcccagatggtggac
ctcaaagccaagggctactgggaggaactaatggacgtgttccggcctgacattgtggtt
aaggactggtttgccgccagagcagactgtggctgcacctataacatcaaagtacagctg
ctctcagccaacaacatccccttggcctccttcgagccaccacctgtgaccatcgagcag
tggagcgatgccacgtggacagaggtctcctataccttctcagactaccctccaggcgtc
cgccatgtcttcttccagcatgggggcaaagacacccagttctgggcaggctggtatggg
ccccgcgtcaccaacagcagcatcatcatcagccctaagatgaccaggaacccaaccaac
gcctgccatagctcagcggtgaccctgaccgatcaggagcaggagcgggggcaggcgcag
gggcaggggaaggggaaggggaaggggaaggagtgcactgactacttgccctccgtgctt
catttctacaaacgcttctag

DBGET integrated database retrieval system