KEGG   Miniopterus natalensis (Natal long-fingered bat): 107541504
Entry
107541504         CDS       T05883                                 
Symbol
MAPK3
Name
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04114  Oocyte meiosis
mna04140  Autophagy - animal
mna04148  Efferocytosis
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04350  TGF-beta signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04517  IgSF CAM signaling
mna04520  Adherens junction
mna04540  Gap junction
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05034  Alcoholism
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05208  Chemical carcinogenesis - reactive oxygen species
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107541504 (MAPK3)
   04012 ErbB signaling pathway
    107541504 (MAPK3)
   04014 Ras signaling pathway
    107541504 (MAPK3)
   04015 Rap1 signaling pathway
    107541504 (MAPK3)
   04350 TGF-beta signaling pathway
    107541504 (MAPK3)
   04370 VEGF signaling pathway
    107541504 (MAPK3)
   04371 Apelin signaling pathway
    107541504 (MAPK3)
   04668 TNF signaling pathway
    107541504 (MAPK3)
   04066 HIF-1 signaling pathway
    107541504 (MAPK3)
   04068 FoxO signaling pathway
    107541504 (MAPK3)
   04072 Phospholipase D signaling pathway
    107541504 (MAPK3)
   04071 Sphingolipid signaling pathway
    107541504 (MAPK3)
   04024 cAMP signaling pathway
    107541504 (MAPK3)
   04022 cGMP-PKG signaling pathway
    107541504 (MAPK3)
   04151 PI3K-Akt signaling pathway
    107541504 (MAPK3)
   04150 mTOR signaling pathway
    107541504 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    107541504 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107541504 (MAPK3)
   04148 Efferocytosis
    107541504 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107541504 (MAPK3)
   04210 Apoptosis
    107541504 (MAPK3)
   04218 Cellular senescence
    107541504 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107541504 (MAPK3)
   04520 Adherens junction
    107541504 (MAPK3)
   04540 Gap junction
    107541504 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    107541504 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107541504 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107541504 (MAPK3)
   04613 Neutrophil extracellular trap formation
    107541504 (MAPK3)
   04620 Toll-like receptor signaling pathway
    107541504 (MAPK3)
   04621 NOD-like receptor signaling pathway
    107541504 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    107541504 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    107541504 (MAPK3)
   04660 T cell receptor signaling pathway
    107541504 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    107541504 (MAPK3)
   04659 Th17 cell differentiation
    107541504 (MAPK3)
   04657 IL-17 signaling pathway
    107541504 (MAPK3)
   04662 B cell receptor signaling pathway
    107541504 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    107541504 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    107541504 (MAPK3)
   04062 Chemokine signaling pathway
    107541504 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107541504 (MAPK3)
   04929 GnRH secretion
    107541504 (MAPK3)
   04912 GnRH signaling pathway
    107541504 (MAPK3)
   04915 Estrogen signaling pathway
    107541504 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    107541504 (MAPK3)
   04917 Prolactin signaling pathway
    107541504 (MAPK3)
   04921 Oxytocin signaling pathway
    107541504 (MAPK3)
   04926 Relaxin signaling pathway
    107541504 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    107541504 (MAPK3)
   04919 Thyroid hormone signaling pathway
    107541504 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    107541504 (MAPK3)
   04916 Melanogenesis
    107541504 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107541504 (MAPK3)
   04270 Vascular smooth muscle contraction
    107541504 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107541504 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107541504 (MAPK3)
   04725 Cholinergic synapse
    107541504 (MAPK3)
   04726 Serotonergic synapse
    107541504 (MAPK3)
   04720 Long-term potentiation
    107541504 (MAPK3)
   04730 Long-term depression
    107541504 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    107541504 (MAPK3)
   04722 Neurotrophin signaling pathway
    107541504 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    107541504 (MAPK3)
   04380 Osteoclast differentiation
    107541504 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107541504 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541504 (MAPK3)
   05206 MicroRNAs in cancer
    107541504 (MAPK3)
   05205 Proteoglycans in cancer
    107541504 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    107541504 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    107541504 (MAPK3)
   05203 Viral carcinogenesis
    107541504 (MAPK3)
   05230 Central carbon metabolism in cancer
    107541504 (MAPK3)
   05231 Choline metabolism in cancer
    107541504 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107541504 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107541504 (MAPK3)
   05212 Pancreatic cancer
    107541504 (MAPK3)
   05225 Hepatocellular carcinoma
    107541504 (MAPK3)
   05226 Gastric cancer
    107541504 (MAPK3)
   05214 Glioma
    107541504 (MAPK3)
   05216 Thyroid cancer
    107541504 (MAPK3)
   05221 Acute myeloid leukemia
    107541504 (MAPK3)
   05220 Chronic myeloid leukemia
    107541504 (MAPK3)
   05218 Melanoma
    107541504 (MAPK3)
   05211 Renal cell carcinoma
    107541504 (MAPK3)
   05219 Bladder cancer
    107541504 (MAPK3)
   05215 Prostate cancer
    107541504 (MAPK3)
   05213 Endometrial cancer
    107541504 (MAPK3)
   05224 Breast cancer
    107541504 (MAPK3)
   05223 Non-small cell lung cancer
    107541504 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107541504 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    107541504 (MAPK3)
   05161 Hepatitis B
    107541504 (MAPK3)
   05160 Hepatitis C
    107541504 (MAPK3)
   05171 Coronavirus disease - COVID-19
    107541504 (MAPK3)
   05164 Influenza A
    107541504 (MAPK3)
   05163 Human cytomegalovirus infection
    107541504 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541504 (MAPK3)
   05165 Human papillomavirus infection
    107541504 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107541504 (MAPK3)
   05135 Yersinia infection
    107541504 (MAPK3)
   05133 Pertussis
    107541504 (MAPK3)
   05152 Tuberculosis
    107541504 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107541504 (MAPK3)
   05140 Leishmaniasis
    107541504 (MAPK3)
   05142 Chagas disease
    107541504 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541504 (MAPK3)
   05020 Prion disease
    107541504 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    107541504 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    107541504 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107541504 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107541504 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107541504 (MAPK3)
   04934 Cushing syndrome
    107541504 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107541504 (MAPK3)
   01524 Platinum drug resistance
    107541504 (MAPK3)
   01522 Endocrine resistance
    107541504 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107541504 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107541504 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107541504 (MAPK3)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107541504 (MAPK3)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107541504 (MAPK3)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107541504 (MAPK3)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107541504 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 107541504
NCBI-ProteinID: XP_016074073
LinkDB
Position
Unknown
AA seq 452 aa
MTPSFSLYLPHCMSSTHLPAPTCLGLREPIMGRGGXGVRATRMERVEERGSLERSVSSSL
CEVTEGLPGWSPAFSLEIPGLHSRKEPALFTTWPEPSLLPPFPAMAWVGPPGLDSPFVRP
HQQYLSGPLSSAYDHVRETRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVISIRDIL
RAPTLDAMRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDL
KPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSK
TKVAWSKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFT
FDMELDDLPKERLKELIFQETARFQPGVLEAT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgactccttccttctccctgtatttgcctcactgtatgtcctccactcatctcccagcc
cctacctgtcttgggttgagggagcccatcatgggaaggggagggtgaggggtccgggca
actagaatggaaagggttgaggagaggggaagtctggagcggtcagtctcttcctctctt
tgtgaagtcactgaaggactgcctggctggtccccagctttctccctggagatcccaggc
cttcacagcaggaaggaaccagcattgtttacgacttggccagagccctctttgctccct
cccttccctgccatggcctgggtggggccaccaggcctggactccccctttgtaagacca
caccaacaatacctctctggccctctcagctcagcttacgaccatgtacgtgagacacgc
gtggccatcaagaaaatcagccccttcgagcatcagacctactgccagcgcacgctgcgg
gaaatccagatcttgctgcgcttccgccatgagaatgtcatcagcatccgagacattctt
cgggcacctaccctggatgccatgagggacgtctacattgtgcaggacctgatggagaca
gacctgtacaagttgctcaaaagccagcagctgagcaacgaccacgtctgctacttcctc
taccagatccttcggggcctcaagtatatccactcagccaacgtgctccaccgggattta
aagccctccaacctgctcatcaacaccacctgcgaccttaagatctgcgattttggcctg
gcccggattgccgatcctgagcatgaccacactggcttcctgacagaatatgtggccaca
cgctggtaccgggccccagagatcatgcttaactccaagggctacaccaagtccattgac
atctggtctgtgggctgcattctggctgagatgctctccaaccggcccatcttccctggc
aagcactacctggaccagctcaaccacattctgggtatcctgggctccccatcccaggag
gacctgaattgtatcatcaacatgaaggcccgaaactacctgcagtctctgccttccaag
accaaggtggcctggtccaagctattccccaagtcggactccaaagcccttgacctgctg
gaccggatgttgacctttaaccccaataaacggattacagtagaagaagccctggctcac
ccctacctggagcagtactatgacccaacagatgagccagtggcggaggaacctttcacc
tttgacatggagctggatgatctacccaaggagaggctgaaggagctcatattccaggag
acagcccgcttccagcctggggtgctggaggccacctag

DBGET integrated database retrieval system