KEGG   Miniopterus natalensis: 107541580
Entry
107541580         CDS       T05883                                 

Gene name
CADM3
Definition
(RefSeq) cell adhesion molecule 3 isoform X1
  KO
K06780  cell adhesion molecule 3
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107541580 (CADM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mna04515]
    107541580 (CADM3)
Cell adhesion molecules [BR:mna04515]
 Immunoglobulin superfamily
  Necl family
   107541580 (CADM3)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig C2-set_2 V-set C1-set Ig_5 Syndecan
Other DBs
NCBI-GeneID: 107541580
NCBI-ProteinID: XP_016074184
LinkDB
Position
Unknown
AA seq 374 aa
MLVSQDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQ
LVKSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLITVLGIPQKPIITGYKSSLRE
KETTTLNCQSSGSKPAAHLTWRKGEQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDG
ADIVCSVNHESLNGADRSTSQRIEVLYTPTVKIRPDPPHPREGQKLLLHCEGRGNPVPQQ
YLWEKEGSVPPLKITQESALIFPFLNKSDSGTYGCTATSNMGSHKAYYTLNVNDPSPVPS
SSSTYHAIIGGIVAFIVFLLLILFIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAE
GGQSGGDDKKEYFI
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgctggtcagtcaagacagtcagccctggacatctgatgagaccgtggtggctggcggc
accgtagtgctcaaatgccaagtgaaagaccatgaggactcatccctgcagtggtctaac
cctgctcagcagactctttactttggggagaagagagcccttcgagataatcggattcag
ctggttaaatccacaccccatgagctcagcatcagcatcagcaatgtggccctggcggac
gagggagaatacacctgctccatcttcaccatgcctgtgagaactgccaagtccctcatc
actgtgctgggaatcccacagaagcccataatcactggctacaagtcatcattacgggaa
aaggagacaaccaccctaaactgtcagtcttctgggagcaaacctgcagctcatctcacc
tggcggaagggcgagcaagagcttcatggagaaccaacccgaatacaggaagatcccaat
ggtaaaaccttcaccgtgagcagctcggtgacgttccaggttacccgggaggatgatggg
gccgacatcgtgtgctctgtgaaccacgaatcactaaacggagctgacagatccacctct
cagcgcattgaagttttatacacaccaacagtgaagattaggccagaccctccacatccc
cgcgagggccagaagctgttgctacactgtgagggtcgtggcaatcctgttccccagcag
tacctgtgggagaaggagggcagtgtgccacccctgaagataacccaggagagcgccctg
atcttccccttcctcaacaagagtgacagcggcacctacggctgcacagccaccagcaac
atgggcagccacaaggcttactatactctcaatgtgaacgaccccagtccagtgccctcg
tcctccagcacctaccacgccatcattggcgggatcgtggctttcatcgtctttctgctg
ctcatcctgttcatcttcctgggccactacctgattcggcacaaaggaacctacctgaca
catgaagctaaaggctccgacgacgcgcccgatgcggacacggccatcatcaacgcggaa
ggcgggcagtcaggcggggacgacaagaaggaatatttcatctag

DBGET integrated database retrieval system