KEGG   Miniopterus natalensis: 107541988
Entry
107541988         CDS       T05883                                 

Gene name
ITGAL
Definition
(RefSeq) integrin alpha-L
  KO
K05718  integrin alpha L
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04514  Cell adhesion molecules
mna04613  Neutrophil extracellular trap formation
mna04650  Natural killer cell mediated cytotoxicity
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05144  Malaria
mna05150  Staphylococcus aureus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05169  Epstein-Barr virus infection
mna05323  Rheumatoid arthritis
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107541988 (ITGAL)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107541988 (ITGAL)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107541988 (ITGAL)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107541988 (ITGAL)
   04650 Natural killer cell mediated cytotoxicity
    107541988 (ITGAL)
   04670 Leukocyte transendothelial migration
    107541988 (ITGAL)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107541988 (ITGAL)
   05169 Epstein-Barr virus infection
    107541988 (ITGAL)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107541988 (ITGAL)
  09174 Infectious disease: parasitic
   05144 Malaria
    107541988 (ITGAL)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107541988 (ITGAL)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107541988 (ITGAL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107541988 (ITGAL)
   04515 Cell adhesion molecules [BR:mna04515]
    107541988 (ITGAL)
   04090 CD molecules [BR:mna04090]
    107541988 (ITGAL)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107541988 (ITGAL)
Cell adhesion molecules [BR:mna04515]
 Integrins
  Integrin alpha subunits
   107541988 (ITGAL)
CD molecules [BR:mna04090]
 Proteins
  107541988 (ITGAL)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 HisK_sensor
Other DBs
NCBI-GeneID: 107541988
NCBI-ProteinID: XP_016074668
LinkDB
Position
Unknown
AA seq 1170 aa
MTSGVMAMRLLLSGPLLFALASSYNLDVRHVQNLSFPQAGRHFGYRVLQVGNEVVVGAPG
EGSSAGSLYQCRPDAGRCLPVSLSGSNYTSKYLGMTLATDPTNGKFLTCDPGLSQTCDQN
IYLSGRCYLFQQNLQGPVLKGRPGYQECLKGNVDLVFLFDGSGSLRQDEFQNILKFMKDV
MKKLSNTSYQFAAVQFSSNYKTEFNFVDYVKLKNPDVLLAKVKHMGLLTNTFGAINYVAN
QVFRQELGARPDATKVLIIITDGEATDAGNIAAAEDIIRYIIGIGRHFQTKTSQQTLHKF
ASKPAKEFVKILDTFEKLKDLFTELQKKIYDIEGTSKQDLTSFDMELSSSGISADLSGDH
GVVGAVGAKDWAGGFLDLTADLQDDTFVGNKPLTPEARAGYLGYTVTWLPSRGLTSLLAA
GAPRYQHVGQVLLFQESRDKRQWSQIQKIEGIQIGSYFGGELCGIDMNQDGETELLLIGA
PMFYGEQRGGRVFIYQKKQLGFEAVSELQGDPGYPLGRFGAAITALADLNGDRLMDVAVG
APLEERGAVYIFNGQPGGLSPQPSQRIEGTQMFPGIRWFGRSIHGVKDLGGDGLTDVAVG
AEGQVIVLSSRPVVDVLTLITFHPAEIPVHEVECSHSASDKRKEGVNVTVCFQVKSLTPQ
FQGSLVTNLSYTLQLDGHRPRSRGLFPGGRRELSGTAAVTLVKSCAPFWFHFPVCIQDLI
SPINVSLNYSLWEEEGTPRDRAQGKDMLPILRPLPHSETKEIPFEKNCGEDKKCEANLGL
SFSPARSRVLRLTSSASLSVELTLNNSGEDAYWVQLSLSFPWGLSFRKAEMLKPHSQIPV
SCEELPKEPGLLTRSLSCNVSSPIFKAGSSNVIQVMFHTLPNSSWEDFVKLSANVSCDNE
DSGLLRDNSATTSIPVMHPINILTEAKESSTLYISFTPKGAKIHHVKHIYQVKIQPSVYD
HNVPALEALVGVPQPHSEGLITHKWNVQMECPVTSRDENLQRPPNMGEQACLPGAQFCCP
VGFQEEVLIQVLGTVELVGEIKASSIISLCSSVSISFNSTRHFHLYGINASLAQVIMKVD
IIYEKNMLYLYVLSGIGGLLLLLLIFLALYKVGFFKRNLKEKMEATAGAADGNPGEGSEQ
LAPEEEAVDPSSVDLLAQDAQDAQDGGGAD
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgacctcgggcgtcatggcaatgaggctgctgctgtccgggcctcttctctttgccctg
gcctccagctacaacctggatgtgcggcatgtgcaaaacttgtccttcccacaggccggg
aggcattttgggtaccgcgtcctgcaggttggaaacgaggttgtcgtgggagcgccaggc
gaggggagcagtgcagggagcctctatcagtgccggcccgacgctgggcgctgcctgcca
gtgagcctgagtggttccaactacacctctaagtacttgggaatgaccttggcgacagac
cccacaaatggaaagtttttgacctgcgaccctgggctgtctcagacatgcgaccagaat
atctatctaagtggccggtgctacctcttccagcagaacctgcaggggcctgtgctgaaa
gggcgccccggttatcaggaatgtctcaagggcaacgtagacctggtgtttctatttgat
ggctcggggagcttgcggcaagatgaattccagaacattctgaaattcatgaaggatgtg
atgaagaaactcagcaacacttcctaccagtttgccgctgttcagttttcttcgaactac
aaaacagaatttaatttcgtggactacgttaagctgaagaaccctgatgttctgctggcc
aaagtaaagcacatgggccttctgaccaacacctttggtgccataaactatgtcgcgaac
caggtgttccggcaggaacttggggcgcggccagatgccaccaaagtgctaatcatcatc
acggacggggaagccaccgacgctggcaacatcgccgcggctgaagacatcatccgctac
atcattgggatcggaaggcattttcagacgaagacaagccagcagacgctccacaaattt
gcctcaaaacccgcaaaagagtttgtaaagattctggacacatttgagaagcttaaggat
ctgttcactgagctgcaaaagaagatctatgacatcgagggcacaagcaaacaggacctg
acatccttcgacatggagctgtcctccagtggaatcagcgctgacctcagcggggaccat
ggtgtcgtgggggcagttggagccaaggactgggctggtggctttctagacctgacagca
gacctgcaggatgatacatttgttgggaataagccactgacaccagaagcgagagcagga
tatctgggctacacagtgacctggctgccctcccgaggtcttacatcgctgctggcagct
ggagccccccgataccagcatgtggggcaggtgctgttgttccaagagtcaagggacaaa
agacaatggagccagatccagaaaatagaggggatccagattggctcttatttcggtggt
gagctgtgtggcattgacatgaaccaagatggggagacagagctgttgctgattggtgcc
ccaatgttctatggagagcagagaggaggccgggtgtttatctaccagaaaaaacagctg
gggttcgaagcggtctcagaactgcagggggatccaggctacccccttgggcgatttgga
gccgccatcactgccctggcagacctcaacggcgataggctgatggatgtggctgtggga
gcccctctggaggagcggggtgctgtgtacatcttcaatgggcagcctggtgggctgagc
ccccagccaagtcagcggatagaagggacccagatgttcccaggaatccgatggtttgga
cgctccatccacggggtgaaggaccttggaggggacggcctaacagatgtggctgtgggg
gctgagggtcaggtgatcgtgctgagctcgcggcccgtggtggacgtcctcaccctgata
accttccacccggccgagatcccggtacatgaagtcgagtgctcccattcagccagcgac
aagaggaaggaaggcgtcaacgtcaccgtgtgtttccaggtcaagtctctcaccccccag
ttccaaggatccctggttaccaacctcagttacactctgcagctggatggccatcggccg
cgaagccggggactgttcccaggagggaggcgggagctgagcgggacggcggctgttacc
ttagtcaagtcctgcgctcccttctggttccacttcccggtgtgcattcaggacctcatc
tctcctatcaatgtctccctgaactactctctctgggaggaagaagggacaccgagagac
agggcgcagggcaaggacatgctgcccatcctgagacccttgccacactcagagaccaag
gagatcccttttgagaagaactgtggtgaggacaagaaatgtgaggcaaacctggggctg
tccttctcccctgcaaggtccagagtcctgcgtctgacctcttctgccagcctctccgtg
gagctgaccctgaataactcaggagaagacgcttactgggtccagctcagcctgagtttc
ccctggggactctccttccgcaaagcggagatgctcaagccccacagccagatacctgtg
agctgcgaggagcttcctaaggagcccgggcttctgaccaggagcctctcctgcaacgtg
agctctcccatctttaaagcaggcagctcgaacgtgatccaggtgatgttccacacgctg
cccaacagctcctgggaggactttgtcaagctgagcgccaatgtgagctgtgacaatgag
gactcgggcctcctgagggacaactcagccaccaccagcattccagtcatgcatcccatc
aacatcctcaccgaagccaaggaaagctccacactctacataagtttcacccccaaggga
gccaagatccaccacgtcaagcacatctaccaggtgaagattcagccgtctgtctatgac
cacaatgtgcccgccctggaggccttggttggggtgccgcagcctcacagtgaggggctc
atcactcacaagtggaatgtgcagatggagtgtcctgtcacctctcgcgatgagaatctg
caaaggccacccaatatgggggagcaggcttgtttgcctggagcccagttctgctgccca
gtgggcttccaggaggaggtcctcatccaagtgctcgggaccgtggagctggtgggggag
atcaaggcctcctccatcatcagcctctgcagctccgtttccatctccttcaacagcacc
aggcacttccacctctacggcatcaatgcctccctggcccaggtcatcatgaaggttgac
attatatatgagaagaatatgctctacctctacgtgctgagtggcatcggggggctgttg
ttgctgctgctgattttcctggcgctctacaaggttggcttcttcaagcggaacctgaag
gagaagatggaggctacggccggtgcggccgacgggaaccccggagaaggctccgagcag
ctggcgcccgaggaggaggccgtggatccgagcagcgtggatctcctcgcgcaggacgcg
caggacgcgcaggacggaggcggcgcagactga

KEGG   Miniopterus natalensis: 107543669
Entry
107543669         CDS       T05883                                 

Gene name
ITGB2
Definition
(RefSeq) integrin beta-2
  KO
K06464  integrin beta 2
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04145  Phagosome
mna04390  Hippo signaling pathway
mna04514  Cell adhesion molecules
mna04610  Complement and coagulation cascades
mna04613  Neutrophil extracellular trap formation
mna04650  Natural killer cell mediated cytotoxicity
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05133  Pertussis
mna05134  Legionellosis
mna05140  Leishmaniasis
mna05144  Malaria
mna05146  Amoebiasis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05166  Human T-cell leukemia virus 1 infection
mna05323  Rheumatoid arthritis
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107543669 (ITGB2)
   04390 Hippo signaling pathway
    107543669 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107543669 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107543669 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107543669 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107543669 (ITGB2)
   04613 Neutrophil extracellular trap formation
    107543669 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    107543669 (ITGB2)
   04670 Leukocyte transendothelial migration
    107543669 (ITGB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107543669 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107543669 (ITGB2)
   05134 Legionellosis
    107543669 (ITGB2)
   05150 Staphylococcus aureus infection
    107543669 (ITGB2)
   05152 Tuberculosis
    107543669 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107543669 (ITGB2)
   05144 Malaria
    107543669 (ITGB2)
   05140 Leishmaniasis
    107543669 (ITGB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107543669 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107543669 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107543669 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107543669 (ITGB2)
   04515 Cell adhesion molecules [BR:mna04515]
    107543669 (ITGB2)
   04090 CD molecules [BR:mna04090]
    107543669 (ITGB2)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    107543669 (ITGB2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107543669 (ITGB2)
Cell adhesion molecules [BR:mna04515]
 Integrins
  Integrin beta subunits
   107543669 (ITGB2)
CD molecules [BR:mna04090]
 Proteins
  107543669 (ITGB2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 107543669
NCBI-ProteinID: XP_016076742
LinkDB
Position
Unknown
AA seq 778 aa
MLRQHSPLLTLWGLLSLGSVLSQECTKYKVSTCRDCIESGPGCAWCQKPNFPGQGEPDSV
RCDTRAQLLSKGCAADDIMDPRSFAETKEAHEGGQKQLFPQKVTLYLRPGQEAAFNVTFQ
RAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPKKEKECQAPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHIAGDGKLGAILTPNDGHCHLEDNMYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTKKMVQTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNTLPDTLKVTYDSFCSNGVSQVNQPKGDCDGVQINVPVTFQVKVTATEC
IQEQSFVIRALGFTDTVTVRVLPQCECKCRDRSQDQGLCNNKGSVECGICRCDAGYIGKA
CECQTQGRSSQDLEGSCRKDNSSIICSGLGDCICGQCVCHTSDVPNKKIFGQFCECDNVN
CERYNGKICGGTDRGECRCGKCLCKPGYEGSACQCHKSTDGCRNLQGSVCSGRGQCLCNV
CQCDVGYQLPFCEECPGCLSPCSQHISCAECLKFDKGPFMKTCSMECQNLKLLSEPPEPG
RYRNPKLTRKCRERDSEGCWVTYTMWQVDGKDKHDIYVDEIRECPKGPNVAAIVGGTVAG
VVLIGVLLLVIWKALTHLNDLREYKRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgctgcgacagcactccccgctgctcaccctatggggtctgctctccctcgggtctgtc
ctctcccaggagtgcaccaaatacaaggtcagcacctgccgggactgcatcgagtcaggg
cccggctgcgcctggtgccagaagccgaacttcccggggcaaggagagcccgactccgtt
cgctgtgacacaagggcacagctgctctctaagggctgcgcagccgacgacatcatggac
cccagaagtttcgctgagaccaaggaggcccatgaggggggccaaaagcagctgttccca
cagaaagtgacactctacctgagacctggtcaggaggctgcgttcaacgtgaccttccag
cgcgccaagggctaccccatcgacttgtactacctgatggacctgtcctactccatgctt
gatgacctcatcaatgtcaagaagctggggggtgacctactccgggccctcaacgaaatc
accgagtctggccgcattggcttcggatccttcgtggacaagacggtgctccccttcgtc
aacacacaccccgagaagctaaggaacccgtgccccaaaaaagagaaggagtgccaggcc
ccgtttgccttcaggcatgtgctgaagctcacagacaactccaaccagttccagacagag
gtcgggaagcagctgatttctgggaacctggatgcccctgagggagggctagatgccatg
atgcaggtcgcagcgtgcccggaggaaattggctggcgtaacgtcacaaggctgctggtg
ttcgccaccgacgatggcttccacattgccggcgatgggaagctgggagccattctgacc
cccaacgatggccactgccacttggaggacaacatgtacaaaagaagcaatgagtttgac
tacccatcggtgggccagctggcgcacaaactagccgaaaacaacatccagcccatcttt
gctgtaaccaagaaaatggtgcaaacctatgagaagctcactgagattatccctaaatcg
gcagttggggagctgtcagaagactccagcaacgtggtccagctcattaagaatgcctac
aataaactctcctccagagtctttctggatcacaacacccttcccgacaccctgaaagtc
acctacgactccttctgcagtaatggagtatcacaggtgaaccagcccaaaggggactgc
gacggtgtccagatcaacgttccggtcacctttcaggtgaaggtcacagccacagagtgc
atccaggagcagtcatttgtcatccgggcactgggcttcacggacacggtgaccgtgagg
gtacttccccagtgtgagtgcaagtgcagggacaggagccaggaccaaggcctctgtaat
aacaagggctctgtggagtgcggcatctgtaggtgcgacgctggctacatagggaaggcc
tgcgagtgccagacgcagggccggagcagccaggacctggaagggagctgccgcaaggac
aacagctccatcatctgctcggggctgggcgactgcatctgcgggcagtgcgtgtgccac
acgagcgacgtgcccaacaagaagatctttgggcagttctgcgagtgtgacaatgtcaac
tgcgagcgctacaatggcaaaatctgtgggggcactgatcgtggggaatgccgctgcggc
aagtgcctctgcaaacccggctatgagggctcggcctgccagtgccacaagtccaccgat
ggctgccggaacctgcaggggtctgtctgcagcggccgtggccagtgcctctgcaatgtg
tgtcagtgtgacgtaggctaccagctgcccttctgtgaggagtgcccaggctgcctgtcg
ccctgcagccagcacatctcctgtgctgagtgcctgaaattcgacaagggccccttcatg
aagacctgcagtatggagtgtcagaacctgaaactgctgagcgagccccccgagccgggt
cggtataggaatcccaaactgacgcggaaatgcagggagcgagactcggagggctgctgg
gtgacctacaccatgtggcaggtggatgggaaggacaaacatgacatctacgtggatgag
attcgagagtgtccgaaaggtcccaacgtagccgccatcgtggggggcactgtggcagga
gttgtgctgatcggtgtcctcctgctggtcatctggaaagctctgacccacctgaatgac
ctccgggagtacaagcgcttcgagaaggagaaactcaagtctcagtggaacaatgataac
ccccttttcaagagcgccacaacgacagtcatgaaccccaagtttgctgagagttag

DBGET integrated database retrieval system