KEGG   Miniopterus natalensis: 107542654
Entry
107542654         CDS       T05883                                 

Gene name
TSHR
Definition
(RefSeq) thyrotropin receptor
  KO
K04249  thyrotropin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04918  Thyroid hormone synthesis
mna04923  Regulation of lipolysis in adipocytes
mna05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107542654 (TSHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107542654 (TSHR)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107542654 (TSHR)
   04918 Thyroid hormone synthesis
    107542654 (TSHR)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107542654 (TSHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107542654 (TSHR)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Thyrotropin
    107542654 (TSHR)
SSDB
Motif
Pfam: 7tm_1 LRR_8 LRR_5 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107542654
NCBI-ProteinID: XP_016075571
LinkDB
Position
Unknown
AA seq 769 aa
MALGPCRARPVPLLQLALLLGLPGSPGGRGCLSPPCQCHQEDDFRVTCKDIHRIPSLPPG
TQTLKFIETHLKTIPSHAFSNLPNISRIYLSIDTTLQRLESHAFYNLSKMTHIEIRNTRS
LTYIDPGALRELPLLKFLGIFNTGLKIFPDLTTVYSTDVFFILEITDNPYMTSIPANAFQ
GLCNETLTLKLYNNGFTSIQRHAFNGTKLDAVYLNKNKYLTVIDKDAFGGAHSGPTLLDV
SYTSVTTLPSKGLEHLRELIARNTWTLKKLPISLSFLHLTRADLSYPSHCCAFKNQKKIR
GILESLMCNESSIRSLRQRRSVNALNGPFYQEYEEDPGDHSTGYKENSKGPDTHSHYYVF
FEEQEDEIIGFGQKLKNPQEETLQAFDNHYDYTVCGGNEDMVCTPKSDEFNPCEDIMGYK
FLRVVVWFVSLLALLGNVFVLAILLTSHYKLTVPRFLMCNLAFADFCMGMYLLLIASVDL
YTHSEYYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRL
RHACAIMAGGWLCCFLLALLPLVGISSYAKVSICLPMDTDTPLALAYIILVLLLNIVAFI
IVCFCYVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFMCMAPISFYTLSALMNKPLIT
VTNSKILLVLFYPLNSCANPFLYAIFTKTFQRDVFILLSKFGICKRQAQAYRGQRVSPKN
RTDIQVQKVTPDTRPNLPNIQEDYELLENSHLTPNKQNHISKEYKQTVL
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggccctgggcccgtgcagggcgaggcccgtgcccctgctgcagctggcgctgctgctc
ggcctgcccgggagcccggggggcagagggtgtctctctccgccctgccagtgccaccag
gaggacgacttcagagtcacctgcaaggacatccaccgcatccccagcctaccgcccggc
acgcagaccctgaagtttatagagactcatctgaaaaccattcccagtcatgccttttca
aatctgcccaatatttccaggatctacttatcaatagatacaactctgcagcggctggaa
tcacatgccttctacaatctgagtaaaatgacgcacatagagattcggaataccaggagc
ttgacctacatcgaccccggagccctgcgggagctgcccctgctgaagttccttggcatt
ttcaacactgggcttaaaatattccctgacctgaccacagtgtactccactgatgtgttc
ttcatactggaaattacagacaacccctacatgacttccatccctgccaatgctttccag
ggactgtgcaatgaaaccttgacactgaaactgtacaacaatggctttacttcaatccaa
agacatgctttcaatgggacaaagctggatgctgtttacctgaacaagaacaaatacctg
acagttattgacaaagacgcatttggaggagcacacagtgggccaaccttgctggatgtc
tcttataccagtgtcactaccctgccatccaaaggcctggagcacctcagggaattgata
gcaagaaacacatggactctaaagaaacttccaatttccttgagtttcctccacctcaca
cgggctgacctttcttatccaagccactgctgtgcttttaagaatcagaagaaaatcaga
ggaatccttgagtctttgatgtgtaacgagagcagcattcggagcctgcgccagagaaga
tctgtgaatgctttgaatggtcccttctaccaggaatatgaagaggatccgggtgaccac
agcaccgggtacaaggaaaactccaagggcccggacacccactctcattattacgtcttc
tttgaagaacaggaagatgagatcattgggtttggccagaagctcaaaaacccacaggaa
gagaccctccaggcctttgataaccattatgactacacggtgtgtgggggcaatgaggac
atggtgtgcacccccaagtcagatgagttcaacccctgtgaagacataatgggctacaag
ttcctgagggtggtggtgtggtttgtgagcctgctggccctcttgggcaatgtctttgtc
ctggccatcctcctcaccagccactacaagctgaccgtcccgcgctttctcatgtgcaac
ctggccttcgcggacttctgcatgggcatgtacctactgctcattgcctccgtggacctc
tacacccattcggagtactacaaccacgccatcgactggcagacgggccccgggtgcaac
acggctggattcttcacggtcttcgcgagcgagctgtcggtgtacacgctgacggtgatc
accctggagcgctggtacgccatcaccttcgccatgcgcctggaccggaaaatccgcctc
aggcacgcgtgcgccatcatggccgggggctggctctgctgcttcctgctcgccctgctc
cccttggtgggcataagcagctatgccaaggtcagcatctgcctgcccatggacaccgac
acccctcttgccctggcctatataatcctcgtcttgctgctcaacatagtcgccttcatc
atcgtctgcttctgttacgtgaagatctacatcacagtccgaaacccccagtacaaccca
ggggacaaagacaccaaaattgccaagaggatggctgtgctgatcttcactgacttcatg
tgcatggcccccatctcgttttatactctgtcagctcttatgaacaagcctcttatcact
gttaccaactccaaaatcttgctggttctcttctatccacttaactcctgcgccaatcca
tttctctatgccattttcaccaagaccttccagcgggacgtatttatcctgctcagcaag
tttggcatctgtaagcgccaggctcaggcgtacaggggccagagggtttctccaaagaac
aggactgatattcaggtccaaaaggtcaccccagacacaaggccaaatctccccaacata
caggaagactatgaactgcttgaaaactcccatctaaccccaaataagcagaaccacatc
tcaaaagagtataagcaaacggttttgtaa

DBGET integrated database retrieval system