KEGG   Miniopterus natalensis (Natal long-fingered bat): 107543089
Entry
107543089         CDS       T05883                                 
Symbol
PLAA
Name
(RefSeq) phospholipase A-2-activating protein
  KO
K14018  phospholipase A-2-activating protein
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107543089 (PLAA)
SSDB
Motif
Pfam: PUL PFU WD40 WD40_like
Other DBs
NCBI-GeneID: 107543089
NCBI-ProteinID: XP_016075991
LinkDB
Position
Unknown
AA seq 796 aa
MESGAARYRLSCSLPGHELDVRGLVCCLYPPGAFVSVSRDRTTRLWVPDSLNRGFTEMHC
MSGHSNFVSCVCIIPSSDVYPHGLIATGGNDHNICIFSLESPAPLYILKGHKNTVCSLSS
GKFGTLLSGSWDTTAKVWLNDKCMMTLQGHTAAVWAVKILPEQGLMLTGSADKTIKLWKA
GRCERTFSGHEDCVRGLAILSETEFLSCANDASVRRWQITGECLEVYYGHTNYIYSISVF
PNCKDFVTTAEDRSLRIWKNGECAQTIRLPAQSIWCCCVLDNGDIVVGASDGIIRVFTES
VDRTASAEEIKAFEKELSQATIDSKTGDLGDINAEQLPGREHLNEPGSREGQTRLIRDGE
KVEAYQWSVSEGRWVKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPY
NISDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNTSYSDPFTGGGRYVPG
SSSGSSNTLPAADPFTGGGRYVPGSASTGTTMAGVDPFTGNSAYRSASSKSVNIYFPKKE
AVTFDQANPTQILGKLKELNGTAPEEKKLTEDDLILLEKILSLICNSSSEKPTAQQLQIL
WKAINWPEDIVFPALDILRLSIKHPSVNENFCNEKEGAQFSSHLISLLNPKGKPANQLLA
LRTFCNCFVGQAGQKLMMSQREALMSHAIELKSGSNKNIHIALATLTLNYSVCFHKDHNI
EGKAQCLSVISTIFEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYASVS
EPAKVSECCRLILNLL
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggagagcggcgccgccaggtatcggctgagctgctcgctgccgggccacgagctggac
gtgcggggcctggtgtgctgcctctatccgccgggcgcctttgtgtccgtgtctcgggac
cggaccacccgcctctgggtcccggacagtcttaacaggggcttcacagaaatgcactgt
atgagtggccactccaattttgtatcttgtgtatgcatcataccttcaagtgatgtttac
cctcatggactaattgccactggaggaaatgaccacaatatttgcattttctcactggag
agtccagcaccactttatatattaaaaggtcacaaaaatactgtttgtagtctttcatct
ggaaaatttgggacattacttagtggctcatgggacaccactgctaaagtctggctgaat
gacaaatgcatgatgaccttacagggtcatacagctgcagtctgggcagtaaagatcttg
cctgaacagggtttaatgttaactggatcagcagacaagactattaaactgtggaaagct
ggaagatgtgagaggactttttcagggcatgaagactgtgtaagaggtttggcaatttta
agtgaaacagaatttctttcctgtgcaaatgatgccagtgttagaaggtggcaaatcact
ggcgagtgtcttgaagtatattatggacatacaaattatatttatagcatatctgtcttt
ccaaattgtaaagattttgtgacaacagcagaagacagatctctgagaatctggaaaaat
ggggaatgtgctcaaacaatccgacttccagctcagtctatatggtgctgctgtgtgcta
gacaatggtgacattgtggttggtgcaagtgatggtattattagagtgtttacagaatca
gtggatcggacagcgagtgctgaggaaatcaaggcttttgaaaaagaactctctcaggca
accattgattccaaaactggtgatttaggggacattaatgcagagcagcttcctgggagg
gaacatctgaatgaacctggctctagagaaggacagactcgcctgatcagagatggggag
aaagtcgaagcttatcagtggagtgtgagtgaagggaggtgggttaagatcggcgacgtt
gtcggctcatctggtgctaatcagcaaacatctggaaaagttttatatgaagggaaagaa
tttgattatgttttctcaattgatgtcaatgaaggtggaccatcctataaattgccatat
aacatcagtgatgatccctggttaactgcatacaacttcttgcagaagaatgatttgaat
cccatgtttttggatcaagtggcaaaatttattattgataacacaaaaggtcaaatgttg
ggacttgggaacaccagttattcagatccatttacaggtggtggtcggtatgttccaggc
tcttcatcaggatcttccaacacactgcctgcagcagatccttttacaggtggaggtcgt
tatgtgccagggtctgcaagtacgggaactaccatggctggagttgatccatttacaggg
aatagtgcctaccgatcagcttcatctaaatcggtgaatatttatttccctaaaaaagag
gctgtcacttttgaccaagcaaaccctacacaaatactaggtaaattgaaggagcttaat
ggaactgcacctgaagagaagaagttaactgaggatgacctgatacttcttgagaagata
ctatctctaatatgtaatagttcctcagaaaaacccacagcccagcaacttcagattttg
tggaaagctattaactggcctgaagatatcgtctttcctgcgcttgacattcttcggttg
tcaattaaacatcccagtgtgaatgagaacttctgcaatgaaaaggaaggggctcagttc
agcagtcatcttatcagtcttctgaaccctaaaggaaagccagcaaaccagctgcttgct
ctgaggactttttgcaattgttttgttggccaggcaggacaaaagctcatgatgtcccag
agggaagcactgatgtcccatgcaatagaactgaaatcagggagcaataagaacattcac
attgctctggctaccttgaccctgaactattctgtttgttttcataaagaccataacatt
gaaggaaaagctcaatgcttgtcagtaattagcacaatcttcgaagttgtacaagaccta
gaagccacttttagacttcttgtggctcttggaacactgattagtgatgattcaaatgct
gtacaattagccaagtctttaggtgttgattctcaaataaaaaaatatgcctcagtatca
gaaccagccaaagtaagtgaatgctgtagacttatcctaaatttgctgtaa

DBGET integrated database retrieval system