KEGG   Miniopterus natalensis (Natal long-fingered bat): 107543221
Entry
107543221         CDS       T05883                                 
Symbol
STUB1
Name
(RefSeq) E3 ubiquitin-protein ligase CHIP isoform X1
  KO
K09561  STIP1 homology and U-box containing protein 1 [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107543221 (STUB1)
   04120 Ubiquitin mediated proteolysis
    107543221 (STUB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107543221 (STUB1)
   04131 Membrane trafficking [BR:mna04131]
    107543221 (STUB1)
   04121 Ubiquitin system [BR:mna04121]
    107543221 (STUB1)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107543221 (STUB1)
Chaperones and folding catalysts [BR:mna03110]
 Other chaperones and cochaperones
  Others
   107543221 (STUB1)
Membrane trafficking [BR:mna04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    107543221 (STUB1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  U-box type E3
   107543221 (STUB1)
SSDB
Motif
Pfam: U-box CHIP_TPR_N TPR_1 TPR_2 ANAPC3 TPR_16 TPR_8 TPR_11 TPR_12 TPR_17 TPR_19 TPR_6 TPR_14 TPR_9 zf-NOSIP TPR_10
Other DBs
NCBI-GeneID: 107543221
NCBI-ProteinID: XP_016076178
LinkDB
Position
Unknown
AA seq 303 aa
MKGKEEKEGGARLGAAGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVA
VYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YNLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQENELHSYLTRLIVAERERELEEC
QRNHEGDEDDGHIRAQQACIEAKHDKYLADMDELFSQVDEKRKKRDIPDYLCGKISFELM
REPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWV
EDY
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaagggcaaggaggagaaggagggcggcgcgcggctgggcgcagctggcggaagcccg
gagaagagcccgagcgcgcaggaactcaaggagcagggcaaccggctcttcgtgggccgc
aagtatccggaggcggcggcctgctatggccgcgccatcactcggaatcccttggtggca
gtgtattacaccaaccgggcactgtgctacctgaagatgcagcagcatgagcaggcgctg
gctgactgccggcgcgccctggagctggatgggcagtctgtgaaggcacactttttcctg
gggcaatgccagttggagatggagagctacgatgaggcgattgccaacctgcagcgagcc
tacaacctggctaaggagcagcggcttaactttggggatgatatccccagtgctttgcgc
atcgccaagaagaagcgctggaatagcatcgaggagcggcgcatccaccaggagaatgag
ctgcactcctatctcacgcgactcattgtggctgagcgtgagagggagctggaagagtgt
cagcggaaccatgagggtgacgaggatgatggtcacatccgggcccagcaggcctgcatc
gaggccaagcacgacaagtacttagcagacatggatgagctcttctcccaggtggatgag
aagagaaagaagcgagacatccctgattacctgtgtggcaaaatcagctttgagctgatg
cgggagccgtgcatcacacctagtggcatcacctatgaccgtaaggacattgaggagcac
ctgcagcgtgtgggccactttgaccctgtgacccggagccctctgacccaggaacagctc
atccccaacctggccatgaaagaggtcatcgatgcattcatctctgagaatggctgggtg
gaggactactga

DBGET integrated database retrieval system