KEGG   Miniopterus natalensis: 107543855
Entry
107543855         CDS       T05883                                 

Gene name
LMNA
Definition
(RefSeq) lamin
  KO
K12641  lamin A/C
Organism
mna  Miniopterus natalensis
Pathway
mna04210  Apoptosis
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107543855 (LMNA)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107543855 (LMNA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107543855 (LMNA)
   05414 Dilated cardiomyopathy
    107543855 (LMNA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107543855 (LMNA)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     107543855 (LMNA)
SSDB
Motif
Pfam: Filament LTD TPR_MLP1_2 Crescentin HAUS-augmin3 Fez1 TolA_bind_tri ATG16 CENP-F_leu_zip Tht1
Other DBs
NCBI-GeneID: 107543855
NCBI-ProteinID: XP_016077045
LinkDB
Position
Unknown
AA seq 664 aa
METPSQRRATRSGAQTSSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
TKKEGDLMAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LSDALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLTAKEAKLRDLEDSLSRERDTSRRLLAEKEREMADMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSITKKRK
LESSESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT
YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVDDDDDEDGDDLIHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASA
SGSGAQVGGSISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSRRTQNPQN
CSIM
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggagaccccgtcccagcggcgcgccacccgcagtggggcgcagaccagctccactccg
ctgtcgcccacccgaatcacccggctgcaggagaaggaggacctgcaggagctcaatgac
cgcttggcagtctacatcgaccgggtgcgctcgctggagacggagaacgcaggtctgcgc
cttcgcatcaccgagtctgaggaggtggtcagccgcgaggtgtccggcatcaaggccgcc
tatgaggccgagctcggcgatgcccgcaaaaccctcgactcggtggccaaggagcgtgcc
cgcctgcagctggagctgagcaaagtgcgagaagagtttaaggagctcaaagcgcgcaat
accaaaaaggaaggagacttgatggctgcccaggcccggctcaaggacctggaggctctg
ctcaactccaaagaggctgcactgagcactgctctcagtgagaagcgcacgctggagggt
gagctgcacgacctgcggggtcaagtggccaagctggaggcagccctaggtgaggccaag
aaacaacttcaggatgagatgctgcggcgggtagatgctgagaacaggctgcagaccctg
aaggaggaactggacttccagaagaatatctacagcgaggagctgcgtgagaccaagcgc
cgccatgagacccggctggtggagattgataacgggaagcagcgagagtttgagagccgg
ctgtcagatgccctgcaggagctgcgggcccaacatgaggaccaggtggaacagtacaag
aaggagctggagaagacctattctgctaagctggataatgccaggcaatcagccgagagg
aacagcaacctggtgggggccgcgcatgaggagctgcagcagtcccgaattcgcatcgac
agcctctcagctcagctcagccagctgcagaagcagctgacagctaaggaagcgaagctg
cgggacctggaggattcactgtcccgtgagcgggacaccagccggcggctactggccgag
aaggagcgggagatggcagatatgcgggcaaggatgcagcagcagctggacgagtaccag
gagctgctggacatcaagctggcgctggacatggagatccacgcctaccgcaaactcctg
gagggcgaggaggagaggctacgcctgtcccccagccccacctcgcagcgcagccgcggc
cgcgcctcctcgcactcgtcccagacacagggcgggggcagcatcaccaagaagcgcaag
ctggagtcgtcggagagccgcagcagcttctcgcagcacgctcgcaccagcgggcgcgtg
gccgtggaggaggtcgatgaggaaggcaagttcgtgcggctgcgcaacaagtccaatgag
gaccagtccatgggcaactggcagatcaagcgccagaatggagatgatcccctgctgacc
taccgcttcccaccaaagttcaccctgaaggctgggcaggtggtgacgatctgggctgca
ggagcgggggccacccatagcccccctaccgacttggtgtggaaggcacagaacacctgg
ggctgtggaaacagcctgcgcacggctctcatcaactccactggggaggaggtagccatg
cgcaagctggtgcgctcagtgactgtggtcgatgatgatgacgatgaggacggagatgac
ctgatccatcaccaccacggatcccactgcagcagctcgggggacccagctgagtacaac
ctgcgctctcgcactgtgctgtgcgggacttgcgggcagcccgccgataaggcgtctgcc
agcggctcaggagcccaggtgggcggatccatctcctctggctcttctgcctccagtgtc
acagtcactcgcagctaccgcagtgtggggggcagtgggggtggcagcttcggggacaac
ctggtcacccgctcctacctcctgggcaactccagtcgccgaacccagaacccccagaac
tgcagcatcatgtaa

DBGET integrated database retrieval system