KEGG   Miniopterus natalensis: 107544003
Entry
107544003         CDS       T05883                                 

Gene name
C1R
Definition
(RefSeq) complement C1r subcomponent isoform X1
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04610  Complement and coagulation cascades
mna05133  Pertussis
mna05150  Staphylococcus aureus infection
mna05171  Coronavirus disease - COVID-19
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107544003 (C1R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107544003 (C1R)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107544003 (C1R)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107544003 (C1R)
   05150 Staphylococcus aureus infection
    107544003 (C1R)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107544003 (C1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107544003 (C1R)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544003 (C1R)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     107544003 (C1R)
Peptidases and inhibitors [BR:mna01002]
 Serine peptidases
  Family S1: chymotrypsin family
   107544003 (C1R)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Phagocytosis
   Opsonins
    107544003 (C1R)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF CUB_2 FAM101
Other DBs
NCBI-GeneID: 107544003
NCBI-ProteinID: XP_016077225
LinkDB
Position
Unknown
AA seq 704 aa
MWLLYLLVSVLFCRLGGSIPIAQELYGEVTSPLYPKPYPNNFETTTVITVATGYRVKLVF
WQFDLEPSEGCFYDYVKISADKRTLGRFCGQQDSPLGNPPGNTEFISEGNKMLLTFHTDF
SNEENGTMMFYKGFLAYYQAVDVDECVSQQNAVKEDSQPRCQHLCHNYVGGYFCSCRPGY
ELQKDGHSCQVECSSELYTEPAGYVFSMEYPQPYPPDLRCNYSIRVERGYTIHLKFLEPF
EIDDHQQVHCPYDQLQIYASGRNIGEFCGKQRPADLDTNSNAVDLLFFTDDSGDSRGWKL
HYTTSIIKCPQPKTLDEFTIIQNLQSQYQFRDYFIATCKQGYQLVEGNQVLLSFTAVCQD
DGTWHRAMPRCRIKDCGKPQRIRNGAFMYITTKSVNTYQARIQYYCNEPYYKMKTRSGSS
KSEQGIYTCTAQGIWKSEEEGEKIPRCLPVCGKPIHPVEEKQRIIGGQEAKMGNFPWQVF
TNIYGRGGGALLGDRWILTAAHTLFPKEYSSQANASIDVFMGHVSVEEITKLANHPVRRV
HIHPDYHQEESHNFEGDIALLELENSVTLGPNLLPICLPDNETFYERGLMGYVSGFGIRE
DRLAHNLRFVRLPMAQRELCEKWLRDKNRKDVFSENMFCAGDPTQKQDACQGDSGGVYAV
KDANDRWVATGIVSWGIGCSRGYGFYTKLLSYVDWIKKEMEGEG
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgtggcttttatacctcctggtgtcagtcctgttctgcaggctgggaggctccatcccc
atcgctcaggagctctatggggaggtgacttcccctctgtaccccaagccttaccccaac
aactttgagaccacaactgtgatcacagttgccacaggatacagggtgaagctcgtcttc
tggcagtttgacctggagccttctgaaggctgtttctatgactatgtcaagatctctgct
gataagagaaccctggggaggttctgtgggcaacaggattctccactgggcaacccccca
ggaaatacagaatttatatctgaaggaaacaagatgctactgaccttccacacagacttc
tccaacgaggagaatggcaccatgatgttctacaaaggcttcttggcctactaccaagct
gtggacgttgatgaatgtgtttcccagcaaaatgcagttaaggaggattcccagccccgg
tgccaacacctttgtcacaactatgttggcggttacttctgttcctgtcgtccaggctat
gagcttcagaaggatggacattcctgccaggttgagtgcagcagtgagctgtacacagag
ccagcaggctacgtgttcagcatggagtacccccagccctacccccctgacctgcgctgc
aactacagcatccgagtggagcggggctacaccatccacctcaagttcctggagcctttt
gaaattgatgaccaccagcaagtacactgcccctatgaccagctacagatctatgccagt
gggaggaacatcggcgagttctgtgggaagcaaagacccgctgaccttgacaccaacagc
aatgctgtggatctgctgttcttcacagacgattcgggggacagccggggctggaagctg
cactataccacttcaatcatcaagtgcccgcagcccaaaaccctagatgagttcaccatc
atccagaacctgcagtctcagtaccagttccgtgactacttcattgccacctgcaaacaa
ggctaccagctcgttgagggcaaccaggtgctgctttccttcacagctgtctgccaggat
gatggcacatggcatcgtgccatgcccaggtgcaggatcaaggactgtgggaagccccaa
aggatacgtaatggggccttcatgtatatcaccacaaagagcgtgaacacctaccaggcc
cgtatccagtactactgcaatgagccatattacaagatgaagaccagaagtggtagcagc
aagtccgagcaagggatatatacctgcacagcccagggcatttggaagagtgaagaggaa
ggagagaagattcctcggtgtttgccagtgtgtgggaaacccatccaccctgtggaagag
aagcagcgcatcattggagggcaagaagccaagatgggcaacttcccctggcaggtgttc
accaacatctatgggagagggggtggagccctgctgggcgaccgctggatcctcacagct
gcccacaccctcttccccaaggagtacagctcgcaagccaatgccagcatagatgtgttc
atgggccacgtaagcgtggaagagatcacaaaactagcaaaccaccctgtccgcagggtc
cacatccacccagactaccaccaggaagagtcccacaactttgagggggacattgccctc
ctggaactggaaaatagtgtcaccctaggccccaacctcctgcccatctgcctccctgac
aacgagaccttctatgagaggggactcatgggctatgtcagtggattcgggataagggaa
gataggctcgctcataatctcagatttgtccgtctgcccatggctcaacgagagctatgt
gagaagtggctccgggataaaaacaggaaagacgtgttctctgaaaacatgttctgtgct
ggggacccgactcaaaagcaggatgcctgtcagggggacagtggaggggtctatgcagtg
aaggatgcgaacgaccgctgggtggccacgggcatagtatcctggggcatcgggtgtagc
agggggtacggattctacaccaaattactcagctacgtggactggatcaagaaagagatg
gagggagagggctga

DBGET integrated database retrieval system