KEGG   Miniopterus natalensis (Natal long-fingered bat): 107544319
Entry
107544319         CDS       T05883                                 
Symbol
ERLEC1
Name
(RefSeq) endoplasmic reticulum lectin 1
  KO
K14008  endoplasmic reticulum lectin 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107544319 (ERLEC1)
SSDB
Motif
Pfam: PRKCSH PRKCSH_1
Other DBs
NCBI-GeneID: 107544319
NCBI-ProteinID: XP_016077660
LinkDB
Position
Unknown
AA seq 554 aa
MLMCRLPRKRWWVAQGGRGGVAGLSGRRRGGGWAPGCLGVLVVPPPPPPPPPPLLSGREG
CGGGWRNRRWRMEEGGGGARSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPG
TEFSLPTTGVLYKEDNYVIMTTTHKEKYKCILPLVTGGDEEEEKDYKGPNPRELLEPLFK
QSSCSYRIESYWTYEVCHGKHIRQYHEEKESGQKVNIHEYYLGNMFAKTLLPEKEQEAEE
KEKSKEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSSTVLYICHPESKHEILSVAEV
TTCEYEVVILTPLLCNHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQEEILRVPFR
RNKEEDLHSTKEERFPAVHKPIAVGSQPMLTVGTTHISKLTDDQLIKEFLSGSYCFHGGV
GWWKYEFCYGRHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQSVR
MVSHFYGNGDICDITDKPRQVTVKLKCKESDSPHAVTVYMLEPYSCQYILGVESPVICKI
LDTADENGLLSLPN
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgttgatgtgccgcctgccccggaagcggtggtgggtggcccaagggggcaggggcggc
gtagccgggctctccggaaggagacgtggcggcggttgggccccgggctgcctgggcgtt
ttagtagtcccgccgcctcctcctcctcctccccctcctctcctcagcggcagagaaggc
tgcggcggcggctggagaaatcggcggtggaggatggaggaaggaggcggcggcgcgcgg
agtctggtcccgggcgggccggtgctattggtcctgtgcggcctcctagaggcgtccggc
ggcggccgagcgctcccccaactcagcgatgacatccctttccgagtcaactggcccggc
accgagttctctctgcctacaactggagttctgtataaagaagataattatgtcatcatg
acaactacacataaagaaaaatataaatgcattcttcctcttgtgacaggtggggatgag
gaagaagaaaaggattataaaggccctaatccaagagagctattggagccactatttaaa
caaagcagttgttcctacagaattgagtcttattggacttatgaagtatgtcacggaaaa
catattcggcagtaccatgaagaaaaagaaagtggtcagaaagtaaatattcacgagtac
taccttgggaatatgtttgctaagacccttctacctgaaaaagaacaagaagcagaagaa
aaggaaaaatcaaaagagattcccactaaaaatatcgaaggtcagatgacaccctactat
cctgtgggaatgggaaatggtacaccttgtagtttgaaacagaaccggcccagatcaagt
actgtgctgtacatatgtcatcctgaatctaagcatgaaattctttcagtagctgaagtt
acaacttgtgaatatgaagttgtcattttgacaccactcttgtgcaatcatcctaaatat
agattccgagcatctcctgtgaatgacatattttgccaatcactgccaggatcaccgttt
aaacccctcaccctgagacagctggaacagcaggaagaaattctaagggtgccttttagg
agaaataaagaggaagatttgcactcaactaaagaagagagatttccagcagtccacaaa
cccattgctgttggttctcagccgatgctcactgttggaacaacccacatatccaaactg
acagatgaccagctcataaaagagttccttagtggttcttactgctttcatgggggtgtt
ggttggtggaaatacgaattctgctatggcagacatgtacatcaataccacgaggacaag
gatagtggaaaaacgtctgtggttgtcgggacgtggaaccaagaagagcatattgaatgg
gctaaaaagaatactgctagagcctatcacctacaagacgacggtacccagtcagtcagg
atggtgtcacatttttacgggaatggagatatttgtgatataactgacaaaccaagacag
gtgactgtaaaactaaagtgtaaagaatcagattctcctcatgctgttactgtatatatg
ctagagccttactcctgtcagtatatccttggggttgaatctccagtgatctgtaaaatc
ttagatactgcagatgaaaacggacttctttctctccccaactaa

DBGET integrated database retrieval system