KEGG   Miniopterus natalensis: 107544615
Entry
107544615         CDS       T05883                                 

Gene name
TNFSF13
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 13
  KO
K05475  tumor necrosis factor ligand superfamily member 13
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04672  Intestinal immune network for IgA production
mna05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107544615 (TNFSF13)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    107544615 (TNFSF13)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    107544615 (TNFSF13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107544615 (TNFSF13)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107544615 (TNFSF13)
   04090 CD molecules [BR:mna04090]
    107544615 (TNFSF13)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     107544615 (TNFSF13)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Tumor necrosis fators
   107544615 (TNFSF13)
CD molecules [BR:mna04090]
 Proteins
  107544615 (TNFSF13)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 107544615
NCBI-ProteinID: XP_016078034
LinkDB
Position
Unknown
AA seq 251 aa
MPASSSFLAPKGSPGDMGGRGREPALSVALWLSWGAVLGAVACAMALLIQQTELQILRRE
VTRLQRTGGPSEKGEGYPWLSLQEQEQSPDSLEALENGERSRRRRAVLTHKQKKRHSVLH
LVPINITSKEDSDVTEVMWQPALKRGRGLEAQGYVVRVWDAGIYLLYSQVLFHDVTFTMG
QVVYREGQGKQETLFRCIRSMPSNPDWAYNSCYSAGVFHLHQGDILSVIVPRASAKLSLS
PHGTFLGFVKL
NT seq 756 nt   +upstreamnt  +downstreamnt
atgccagcctcatcttcctttctggcccctaaagggtccccgggagacatggggggccgg
ggccgagagccggcactctcagttgctctctggttgagttggggggcggttttgggggct
gtggcttgtgccatggctctgctgatccaacaaacagagctgcaaatcctaagaagagag
gtgactcggctgcagaggactggagggccctctgaaaagggggaagggtatccatggctg
agcctccaggagcaggagcagagccctgatagcctggaagccctggagaatggggagaga
tcccggagaaggagagcagtgctcacccataaacagaagaagagacactcggttctgcac
cttgttcccattaacattacctccaaggaggactctgatgtgacagaggtgatgtggcaa
ccagctcttaagcgtgggagaggtctggaggcccaaggatatgttgtccgagtctgggat
gctggaatttatctgctgtacagccaggtcctgtttcatgatgtgactttcaccatgggt
caggtggtatatcgggagggccagggaaagcaggagactctattccgatgtatacgaagt
atgccctccaacccagactgggcctacaatagctgctacagtgcaggtgtcttccattta
caccaaggagatattctgagtgtcatagtccccagagcaagtgcgaaacttagcctctct
ccacatggaaccttcctggggtttgtgaaactgtga

DBGET integrated database retrieval system